Gene Information

Name : MMAR_5541 (MMAR_5541)
Accession : YP_001849722.1
Strain : Mycobacterium marinum M
Genome accession: NC_010612
Putative virulence/resistance : Unknown
Product : transposase, ISMyma03_aa1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1712688 - 1713011 bp
Length : 324 bp
Strand : +
Note : transposition of ISMyma03

DNA sequence :
ATGGCACGTGCAAGCAAGTATCCCGAGGAGCTTCGGGAGCGGGCTGTTCGGATGGTCGCTGAGATAGCACCGCAGTACGG
GTCGCAGTGGGCTGCGATCTGCGCTGTGGCGGGCAAGCTGGGAGTGGGCACACCCGAGACGGTGAGGACGTGGGTGCGGC
GCGCTGAGGTCGATGCCGGACAGCGCCCGGGTGTGAGCAGTGAACAGTCCGAGGAACTCAGGCGCCTCAAGCGCGAGAAC
GCCGAATTGCGTAGGGCCAATGAGATTCTCAAAGCAGCAGCAATTTTCTTCGGGGCCGAGCTCGACCGGCCCGCGAGGCG
GTAA

Protein sequence :
MARASKYPEELRERAVRMVAEIAPQYGSQWAAICAVAGKLGVGTPETVRTWVRRAEVDAGQRPGVSSEQSEELRRLKREN
AELRRANEILKAAAIFFGAELDRPARR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 7e-20 49
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-18 49
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-18 49
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 1e-18 49
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 7e-20 49
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 7e-20 49
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 7e-20 49
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 6e-20 48
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 6e-20 48
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 6e-20 48
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 6e-20 48
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 1e-16 48
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 9e-20 48
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-18 47
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 1e-17 47
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-15 47
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 47
unnamed AAF09023.1 unknown Not tested SHI-O Protein 1e-17 47
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 1e-17 47
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 47
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-15 47
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 8e-18 47
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 1e-17 47
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-15 46
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-15 46
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 2e-15 46
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 1e-15 46
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 6e-16 46
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 1e-15 46
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-16 46
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 4e-15 43
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 3e-14 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MMAR_5541 YP_001849722.1 transposase, ISMyma03_aa1 VFG1603 Protein 6e-17 48
MMAR_5541 YP_001849722.1 transposase, ISMyma03_aa1 VFG0643 Protein 3e-18 47
MMAR_5541 YP_001849722.1 transposase, ISMyma03_aa1 VFG1717 Protein 5e-16 46
MMAR_5541 YP_001849722.1 transposase, ISMyma03_aa1 VFG0606 Protein 5e-17 46