
|
Name : mmr (MMAR_1612) Accession : YP_001849918.1 Strain : Mycobacterium marinum M Genome accession: NC_010612 Putative virulence/resistance : Resistance Product : multidrug-transport integral membrane protein Mmr Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 1949997 - 1950320 bp Length : 324 bp Strand : - Note : involved in transport of multidrugs (tetraphenylphosphonium, erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y, etc) across the membrane (export): multidrugs resistance by an export mechanism (conferes resistance to toxic compounds by rem DNA sequence : ATGGCTTACCTACTGTTGTTGGGCGCGATCGCCATGGAGGTGATGGCGACCAGCTTCCTGAAGAGCACCGAGGGCTTCAC CCGACTGTGGCCCACGGTGATCTGCTTGACGGTCTATGGCTTCTCCTTCGCGATGCTGGCGATGTCGATCGCGCGCGGCA TGCAAACCGACGTCGCATACGCACTGTGGTCGGCCATCGGCACCGGCGCCATCGTCCTCATCGCCGTGCTCTTCCTCGGC TCACACTTGTCGCTGACCAAGGTCCTCGGAGTGGGGCTGATCATCGGCGGCGTGCTCACGCTGAACCTGACCGGCGCCCA TTGA Protein sequence : MAYLLLLGAIAMEVMATSFLKSTEGFTRLWPTVICLTVYGFSFAMLAMSIARGMQTDVAYALWSAIGTGAIVLIAVLFLG SHLSLTKVLGVGLIIGGVLTLNLTGAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 6e-07 | 42 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 6e-07 | 42 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 6e-07 | 42 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 6e-07 | 42 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 9e-07 | 42 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 6e-07 | 42 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 6e-07 | 42 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 9e-07 | 42 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 6e-07 | 42 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 9e-07 | 42 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 6e-07 | 42 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 9e-07 | 42 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 6e-07 | 42 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 9e-07 | 42 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 6e-07 | 42 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 6e-07 | 42 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 6e-07 | 42 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 6e-07 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | AE000516.2.gene3301. | Protein | 1e-23 | 77 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | BAC0249 | Protein | 1e-23 | 77 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | NC_002695.1.913273.p | Protein | 1e-08 | 44 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | BAC0150 | Protein | 1e-08 | 44 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | BAC0322 | Protein | 2e-07 | 42 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | BAC0323 | Protein | 3e-07 | 42 |
| mmr | YP_001849918.1 | multidrug-transport integral membrane protein Mmr | BAC0325 | Protein | 2e-10 | 41 |