Gene Information

Name : Bphy_5426 (Bphy_5426)
Accession : YP_001861549.1
Strain :
Genome accession: NC_010623
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2569607 - 2570362 bp
Length : 756 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B0815 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCCACTCAATTCAAGCGAGCCGATGGATCATCCGAAGCGCGTACTGATCGTCGAAGACGATGTCGACATAGCGAATGT
GCTCAGCCTGCACTTGCGGGACGAGCGCTACGAAGTCGTGCATAGCGCCGACGGCAACGAAGGGCTGCGGCTGCTGGAGC
AGGGCAACTGGGACGCGCTGATTCTCGACCTGATGCTGCCCGGCGTCGACGGGCTGGAGATTTGCCGGCGCGCGCGAGCG
ATGGCGCGCTATACGCCCATCATCATCACGAGCGCGCGCTCGAGCGAAGTGCATCGCATCCTTGGACTCGAACTCGGCGC
GGACGACTATCTCGCGAAGCCGTTCTCGGTGCTCGAACTGGTTGCGCGCGTGAAGGCGCTGCTGCGGCGAGCCGATGCGA
TGGCGAAAGACGCGCGCATGGAGGCGGGCAGCCTGAATCTCGCGGGCCTCTTCATCGACCCGCTCACGCGCGAAGCAAGC
GTGAACGGCAAGCGAATCGAACTGACGCCGCGCGAATTCGATCTGCTGTATTTCTTTGCGAGCCGTCCGGGCAAGGTGTT
CTCGCGCATGGATCTGCTCAACGCCGTGTGGGGCTATCAGCACGAAGGCTACGAGCACACCGTCAACACGCATATCAACC
GGCTGCGCGCGAAGATCGAGGACGACCCCGCGCAGCCCGCCCGTATCCTCACGGTCTGGGGGCGCGGCTACAAATTCGTC
GCCGATCCTGCCGTGCACGAGGGAGAAGCGTCGTGA

Protein sequence :
MPLNSSEPMDHPKRVLIVEDDVDIANVLSLHLRDERYEVVHSADGNEGLRLLEQGNWDALILDLMLPGVDGLEICRRARA
MARYTPIIITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRADAMAKDARMEAGSLNLAGLFIDPLTREAS
VNGKRIELTPREFDLLYFFASRPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEDDPAQPARILTVWGRGYKFV
ADPAVHEGEAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-66 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-66 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_5426 YP_001861549.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-40 43
Bphy_5426 YP_001861549.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-38 43
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 43
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 42
Bphy_5426 YP_001861549.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-36 41
Bphy_5426 YP_001861549.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-35 41
Bphy_5426 YP_001861549.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_5426 YP_001861549.1 two component transcriptional regulator VFG1563 Protein 5e-66 61
Bphy_5426 YP_001861549.1 two component transcriptional regulator VFG1702 Protein 4e-66 61