Gene Information

Name : irlR (BAV2048)
Accession : YP_786564.1
Strain : Bordetella avium 197N
Genome accession: NC_010645
Putative virulence/resistance : Virulence
Product : heavy metal sensing two-component sytem response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2192787 - 2193458 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
GTGCGGATATTGATCGTCGAGGATGAGCCTAAGACAGCCGACTATCTTGCAGGGGGGCTGGCTGAGTCCGGCTATGCCGT
GACTGTAGCCCGTGACGGCCGCAGCGCTCAGCATTGTTTTGAATCGGCGCTTTTTGATCTGGTGCTGCTTGATGTGATGC
TGCCCGGCATGGATGGGTGGGAAGTCTTGCGTGTCATCCGACGCAGGGCCAGCACGCCAGTTTTGTTTTTGAGTGCGCGT
GACAGTGTCCAGGATCGTGTCAAAGGTCTGGAGCTGGGGGGTGACGACTATCTGATTAAGCCGTTTTCCTACGCTGAATT
GCTGGCGCGTGTCCGATCTTTGTTGCGTAGGGGGCCTGTGCAGTGCCAGGATGTCCTGCGCCTCGGCGATCTGGAGATGG
TCGTCGGTCGCTTTGAGGTACGCCGTGCTGGCCGCTTGATCCGTCTGACTGCCAAAGAGTTTGTCTTGCTGCGCTTATTG
TTGGAGCGTCAGGGCGAGGTGCTGACGCGCACCATGATTGCCTCGCATGTATGGTTGATGAACTTTGATTGCGACACGAA
TGTCGTGGATGTCGCGATCCGGCGCTTGCGCATGAAAATTGACGAGCCCTATCCCGACCGGCTCATTCATACCGTTCGGG
GGATGGGCTATCGGCTGGCATTGTGCGAATGA

Protein sequence :
VRILIVEDEPKTADYLAGGLAESGYAVTVARDGRSAQHCFESALFDLVLLDVMLPGMDGWEVLRVIRRRASTPVLFLSAR
DSVQDRVKGLELGGDDYLIKPFSYAELLARVRSLLRRGPVQCQDVLRLGDLEMVVGRFEVRRAGRLIRLTAKEFVLLRLL
LERQGEVLTRTMIASHVWLMNFDCDTNVVDVAIRRLRMKIDEPYPDRLIHTVRGMGYRLALCE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-54 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-53 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0197 Protein 6e-62 61
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0125 Protein 1e-59 58
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0083 Protein 2e-57 57
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0638 Protein 6e-53 57
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0308 Protein 2e-57 55
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0111 Protein 1e-54 50
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator BAC0347 Protein 2e-50 49
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator HE999704.1.gene1528. Protein 4e-27 44
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_012469.1.7685629. Protein 7e-36 44
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002952.2859858.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_007622.3794948.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_003923.1003417.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_013450.8614146.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002951.3238224.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_007793.3914065.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002758.1121390.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_010079.5776364.p0 Protein 1e-35 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002952.2859905.p0 Protein 1e-33 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_009641.5332272.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_013450.8614421.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_007793.3914279.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_003923.1003749.p0 Protein 8e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002745.1124361.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_009782.5559369.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002951.3237708.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_007622.3794472.p0 Protein 1e-33 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator NC_002758.1121668.p0 Protein 7e-34 43
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator AE015929.1.gene1106. Protein 4e-31 41
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator AE000516.2.gene3505. Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator VFG0596 Protein 3e-54 55
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator VFG1390 Protein 9e-33 44
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator VFG1386 Protein 4e-36 44
irlR YP_786564.1 heavy metal sensing two-component sytem response regulator VFG1389 Protein 6e-28 43