Gene Information

Name : CLL_A2155 (CLL_A2155)
Accession : YP_001886344.1
Strain : Clostridium botulinum Eklund 17B
Genome accession: NC_010674
Putative virulence/resistance : Resistance
Product : penicillinase repressor
Function : -
COG functional category : K : Transcription
COG ID : COG3682
EC number : -
Position : 2245929 - 2246312 bp
Length : 384 bp
Strand : -
Note : identified by match to protein family HMM PF03965

DNA sequence :
ATGAATGAAATTCCTAAAATATCAAACGCTGAATGGGAAATTATGAAAGTAATATGGAGTCATACTGAAATTACATCAGT
CAATATTATATGTGAACTAAAAGATAAAGTAGAATGGAAACCATCTACAATAAAGAGCTTAATAAATAGATTACTAAAAA
AGAAGGTAATAGGGTTTAAAAGATTAAGTAACGAATACTTATATTTTCCTTTGATATCAGAAGATGAGTGCATAAAGATA
GAAAGCAAATCTTTTATTAATAAAGTCTTCAATGGTTCTGTCAAATCTATGCTTTTAAACTTTGTTGAATCAAAAGAAAT
ATCTGAAACAGACATAGAAGAATTAAAGAACATACTCAAACAATCAAATAAAAAGAAAGGTTGA

Protein sequence :
MNEIPKISNAEWEIMKVIWSHTEITSVNIICELKDKVEWKPSTIKSLINRLLKKKVIGFKRLSNEYLYFPLISEDECIKI
ESKSFINKVFNGSVKSMLLNFVESKEISETDIEELKNILKQSNKKKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 4e-20 47
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 6e-20 44
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 4e-20 44
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-20 44
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 2e-20 44
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 1e-17 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLL_A2155 YP_001886344.1 penicillinase repressor CP001581.1.gene771.p Protein 2e-31 52
CLL_A2155 YP_001886344.1 penicillinase repressor FR823292.1.gene6.p01 Protein 1e-20 47
CLL_A2155 YP_001886344.1 penicillinase repressor NC_002758.1120003.p0 Protein 2e-20 44
CLL_A2155 YP_001886344.1 penicillinase repressor NC_009782.5560220.p0 Protein 2e-20 44
CLL_A2155 YP_001886344.1 penicillinase repressor NC_002745.1122814.p0 Protein 1e-20 44
CLL_A2155 YP_001886344.1 penicillinase repressor NC_002952.2861158.p0 Protein 4e-18 43