Gene Information

Name : Bphyt_4389 (Bphyt_4389)
Accession : YP_001888135.1
Strain :
Genome accession: NC_010676
Putative virulence/resistance : Virulence
Product : two component heavy metal response winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 448093 - 448773 bp
Length : 681 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B0708 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATTCTGCTGGTGGAAGATGAGCCGAAGACCGGCGCCTATTTGCGAAAGGGCTTGTCTGAGGCGGGATACGTGGT
CGACTGGGCGCAAAACGGTGTGACGGGCCAGCATCAGGCGGAGACGGAAGACTACGACCTGCTGATCCTCGATGTAATGT
TGCCGGGACAGGACGGTTGGACGCTGCTGCAAAACCTGCGCCGCAAACGGTGCACGCCGGTGCTGTTTCTCACCGCGCGC
GACGACGTGGGAGACCGCGTCAAAGGCCTGGAGCTCGGCGCCGACGACTACCTGGCGAAGCCGTTCGACTTCGTCGAACT
GATCGCACGCGTGAGGTCGATCCTGCGGCGTGGCAAGCCACGCGAATTCACGTTGCTGAAGGTCGCCGATCTCGAACTGG
ATCTGACGCGGCGTAAGGCGACCCGGCAGCACGACGTGATTTTGCTCACCGCCAAGGAATTCACGCTGCTGTGGCTGCTC
ATGCGCAAGGAAGGGGAAATCCTGCCGCGCGCTACGATCGCCTCGCAAGTGTGGGACATGAACTTCAACAGCGACACGAA
CGTGGTCGATTCGGCAATCCGGCGACTGCGCTCCAAGATCGACGACGCCTACGAACCCAAGCTGATTCACACCGTGAGAG
GCATGGGGTATGTGCTGGAAAACCGGGGCGCCGGCAATTGA

Protein sequence :
MRILLVEDEPKTGAYLRKGLSEAGYVVDWAQNGVTGQHQAETEDYDLLILDVMLPGQDGWTLLQNLRRKRCTPVLFLTAR
DDVGDRVKGLELGADDYLAKPFDFVELIARVRSILRRGKPREFTLLKVADLELDLTRRKATRQHDVILLTAKEFTLLWLL
MRKEGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLENRGAGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-58 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0197 Protein 2e-91 84
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0125 Protein 2e-66 64
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0083 Protein 9e-64 62
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0638 Protein 2e-57 61
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0308 Protein 4e-60 60
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0111 Protein 2e-61 60
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator BAC0347 Protein 3e-56 56
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 5e-35 41
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator VFG0596 Protein 3e-58 58
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator VFG1390 Protein 5e-37 43
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator VFG1386 Protein 3e-33 42
Bphyt_4389 YP_001888135.1 two component heavy metal response winged helix family transcriptional regulator VFG1389 Protein 1e-28 41