Gene Information

Name : Bphyt_4496 (Bphyt_4496)
Accession : YP_001888240.1
Strain :
Genome accession: NC_010676
Putative virulence/resistance : Virulence
Product : two component winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 563128 - 563865 bp
Length : 738 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B0815 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACAATCCGAAGCGCATCCTGATCGTCGAAGACGACATCGACATCGCCAACGTGCTGAGCCTGCATCTGCGCGACGA
GCGCTATGAAGTCGTGCACAGCGCCGACGGCAATGAAGGGCTGCGCCTGCTGGAGCAAGGCGGCTGGGACGCGCTGATTC
TCGATCTGATGCTGCCCGGCGTCGACGGACTGGAAATCTGCCGGCGCGCCCGCGCGATGACGCGCTATACGCCGATCATC
ATCACCAGCGCGCGGTCGAGCGAAGTGCACCGGATTCTCGGCCTCGAACTCGGCGCGGACGACTATCTCGCCAAACCGTT
CTCCGTGCTCGAACTCGTGGCGCGTGTGAAAGCGCTGTTGCGTCGCGTCGACGCGCTGGCGAAAGACTCGAAAATCGAAG
CCGGCAGTCTGCGCATCGCCGGGTTGTCGATCGATCCGCTCACGCGCGAGGCCGCCGTCGACGGCAAGCCGATCGAACTC
ACACCGCGCGAATTCGACCTGCTCTATTACTTCGCGCAACATCCCGGCAAGGTGTTTTCGCGCATGGACCTGCTCAATGC
GGTGTGGGGCTATCAGCACGAAGGCTACGAGCACACCGTCAACACTCATATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCGGCTCAACCCGAGCGCATCCTGACCGTTTGGGGACGCGGCTACAAGCTCGCCGTCCCCGGCGAGCCAGCCGGCGCA
CCGAAGGACGTATCGTGA

Protein sequence :
MDNPKRILIVEDDIDIANVLSLHLRDERYEVVHSADGNEGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALAKDSKIEAGSLRIAGLSIDPLTREAAVDGKPIEL
TPREFDLLYYFAQHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAQPERILTVWGRGYKLAVPGEPAGA
PKDVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-72 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-72 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_012469.1.7685629. Protein 3e-43 45
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator AE000516.2.gene3505. Protein 2e-36 44
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator AF155139.2.orf0.gene Protein 6e-42 43
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 5e-35 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator AE015929.1.gene1106. Protein 5e-30 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_013450.8614421.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_007793.3914279.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002952.2859905.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002745.1124361.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_009782.5559369.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002951.3237708.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_003923.1003749.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_002758.1121668.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_007622.3794472.p0 Protein 1e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_009641.5332272.p0 Protein 2e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator HE999704.1.gene1528. Protein 1e-34 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator AE016830.1.gene1681. Protein 4e-43 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator NC_012469.1.7686381. Protein 3e-40 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator HE999704.1.gene2815. Protein 3e-41 42
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator BAC0533 Protein 2e-29 41
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator CP000647.1.gene4257. Protein 2e-29 41
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator FJ349556.1.orf0.gene Protein 3e-37 41
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator AM180355.1.gene1830. Protein 4e-39 41
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator CP001918.1.gene3444. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator VFG1563 Protein 9e-73 62
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator VFG1702 Protein 1e-72 62
Bphyt_4496 YP_001888240.1 two component winged helix family transcriptional regulator VFG1389 Protein 9e-31 44