Gene Information

Name : Bphyt_1510 (Bphyt_1510)
Accession : YP_001895148.1
Strain :
Genome accession: NC_010681
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1694521 - 1695204 bp
Length : 684 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; KEGG: bxe:Bxe_A2960 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCCTGATCGTCGAGGACGAGATCAAAACCGGCACATATCTTCGCAAAGGCCTGACCGAAGCGGGCTTTATCGT
CGACTGGGTGGAAGACGGCCTGACCGGCCAGCATCGCGCCTTGACGGAGGACTACGATCTGATCGTGCTCGACGTCATGC
TGCCCGGCCAGGATGGCTGGACGGTGCTGAAAAACCTGCGCCGCACCCACTCGACGTCGGTCCTGCTGCTCACCGCGCGC
GACGAAGTGGACGACAAGGTGCGCGGCCTCAACATGGGCGGCGACGACTATCTCGTCAAGCCGTTCGACTTCGCCGAACT
GCTGGCCCGTGTGCGCTCGATTCTGCGACGCGGCCAGACCCGCGACGCCGCCTCGCTTCAAGTAGCGAATCTGGTGCTCG
ACCTGACGCGCCGCAAGGCCACGCGGCACGGCGACATGATCCTGCTCACCGCCAAGGAATTCGCCTTGCTATGGCTGCTG
ATGCGCCGCCAGGGCGAAATCCTGCCGCGTTCGACGATTGCTTCTCAAGTGTGGGACATGAACTTCGACAGCGACACGAA
TGTCGTCGACGCCGCGATCCGCCGCTTGCGCGCGAAGGTCGACGACAACTACGAACCCAAGCTGATCCATACCGTGCGCG
GCATGGGCTATGTATTGGAAGAGCGCGGCCCATCGCAGCCATGA

Protein sequence :
MRILIVEDEIKTGTYLRKGLTEAGFIVDWVEDGLTGQHRALTEDYDLIVLDVMLPGQDGWTVLKNLRRTHSTSVLLLTAR
DEVDDKVRGLNMGGDDYLVKPFDFAELLARVRSILRRGQTRDAASLQVANLVLDLTRRKATRHGDMILLTAKEFALLWLL
MRRQGEILPRSTIASQVWDMNFDSDTNVVDAAIRRLRAKVDDNYEPKLIHTVRGMGYVLEERGPSQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-60 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-58 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 4e-89 80
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 2e-66 62
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 7e-66 61
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 1e-66 61
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-57 59
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 7e-62 59
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-61 57
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-39 44
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 3e-60 59
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 6e-37 43
Bphyt_1510 YP_001895148.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 4e-31 42