Gene Information

Name : Rpic_1718 (Rpic_1718)
Accession : YP_001899288.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1812149 - 1812835 bp
Length : 687 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rso:RSp0655 probable two component response regulator transcription regulator protein

DNA sequence :
ATGAAACTGTTGGTCGTCGAGGACGAGCCCAAAACCGGAGAGTATCTGCAGCAAGGCCTGACCGAAGCCGGCTTTGTGGT
CGATCTGGCACGCAACGGTACTGACGGCCGCCATCTGGCCATGTCGGGCGACTACGACTTGCTGTTGCTGGACGTGATGC
TGCCTGACGTGGATGGCTGGCAGATCGTCCAATCGTTGCGCGCTGCGGAACAGGCGGTGCCGGTGTTGTTCTTGACCGCC
CGCGACAGCGTGGCCGACCGCGTCAAAGGCCTTGAAATGGGCGCCGACGACTACTTGGTGAAGCCATTCGCGTTTGCTGA
GTTGCTAGCCCGGGTCCGCACGCTGCTGCGCCGGGGAACCGGTGCCGTCTCGTCCGACCGAATCCAAGTGGCCGACCTTG
TGCTGGATTTGGCTCGCCGTCGTGCCTCACGCGGAGGCCAGAAGATCCCGCTGACGAGCAAGGAGTTCTCCCTGCTGGAG
CTGCTGGTCCGCCGCCGTGGCGAGGTCTTGCCTCGCTCCCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGTGA
TACCAATGTGATCGACGTCGCCATTCGCCGGTTGCGCGCCAAGATCGACGACCACTTCGAGCCGAAGCTGATCCAAACGG
TACGCGGCATGGGTTATGTACTGGAAGCGCCCGAGGACGCGGCCTGA

Protein sequence :
MKLLVVEDEPKTGEYLQQGLTEAGFVVDLARNGTDGRHLAMSGDYDLLLLDVMLPDVDGWQIVQSLRAAEQAVPVLFLTA
RDSVADRVKGLEMGADDYLVKPFAFAELLARVRTLLRRGTGAVSSDRIQVADLVLDLARRRASRGGQKIPLTSKEFSLLE
LLVRRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDHFEPKLIQTVRGMGYVLEAPEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-47 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-46 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 2e-63 71
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 7e-61 70
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 1e-58 70
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 2e-53 65
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 1e-52 65
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 4e-53 64
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 2e-53 64
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 1e-22 42
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-20 42
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 5e-25 41
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 3e-47 61
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 6e-29 47
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 2e-34 45
Rpic_1718 YP_001899288.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 1e-25 41