Gene Information

Name : Rpic_1760 (Rpic_1760)
Accession : YP_001899330.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1857060 - 1857737 bp
Length : 678 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rme:Rmet_5978 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
GTGCGGGTACTTGTTGTAGAAGACGAACCGCGTACTGCGGAGTATTTGCAGAAGGGATTGTCGGAGTCGGGTTTCGTGGT
CGACATCGCGAACAATGGTGGCGATGGGCTCCACATGGCGGAAGAGACCGACTACGACGTCATCATCCTGGACGTCATGC
TGCCAGGTATGGACGGGTGGACGGTCATCAAGTCCATTCGATCCAAGTCCGAGACACCCGTACTGTTTCTGACGGCGCTG
GATGATGTGGCGGATCGTGTCAGAGGCTTCGAGTTGGGGGCAGACGATTACCTGGTCAAGCCCTTCGCCTTTGCCGAGCT
CCTTGCCCGTATCCGGCGTTGCTTGCGCCAAAGCACCTCGAAGGAGTCCGAGCGATTGCGCATTGCCGATCTGGACATCG
ACGTGCTTGGAAGGCGGGTATTCCGGGGAACTACCCGCATTGAATTGACGAATCAGGAGTTCTCGATGTTGCACCTGCTC
ATGCGCCGGAGAGGGGAGGTGCTGTCGCGAACCACGATCGCGTCCCAGGTCTGGGACGTCAACTTCGACACGGATACCAA
TGTCGTTGACGTCGCGATCCGGCGCCTGAGATCCAAGGTGGATGATCCCTTCGATCAAAAGCTGATCCATACCGTACGGG
GAATGGGCTATGTCCTCGACCCAGAGCGCGGCCGGTGA

Protein sequence :
MRVLVVEDEPRTAEYLQKGLSESGFVVDIANNGGDGLHMAEETDYDVIILDVMLPGMDGWTVIKSIRSKSETPVLFLTAL
DDVADRVRGFELGADDYLVKPFAFAELLARIRRCLRQSTSKESERLRIADLDIDVLGRRVFRGTTRIELTNQEFSMLHLL
MRRRGEVLSRTTIASQVWDVNFDTDTNVVDVAIRRLRSKVDDPFDQKLIHTVRGMGYVLDPERGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-53 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-52 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 3e-95 99
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 2e-62 64
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 1e-58 60
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 6e-52 60
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 2e-53 57
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 4e-58 56
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 8e-54 53
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 4e-30 42
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 3e-28 42
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 3e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-28 41
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 3e-53 56
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 5e-36 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 8e-30 43
Rpic_1760 YP_001899330.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 4e-33 41