Gene Information

Name : Rpic_1783 (Rpic_1783)
Accession : YP_001899353.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1880751 - 1881185 bp
Length : 435 bp
Strand : -
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: bxe:Bxe_C1217 transcriptional regulator, MerR family

DNA sequence :
ATGGAATGCAATCTGATGAATTTGACTATCGGCGCCTTTGCGAAGGCGGCCGAGGTCAATGTGGAGACCATCCGGTTCTA
CCAGCGCAAAGGGTTGTTGTGCGAGCCAGACAAGCCCTATGGCAGCATCCGCCGCTATGGCGAAGCGGATGTGACGCGCG
TGCGGTTCGTGAAATCGGCCCAGCGGCTGGGCTTCAGCCTGGACGAGATTGCCGAGCTGCTGCGGCTGGACGATGGCACC
CATTGCGAGGAGGCCGGCAGCCTAGCCGAGCATAAACTTCAGGATGTGCGAGAGAAGATGGCCGACTTGGCGCGCATGGA
AACCGTGCTATCCAAGCTTGTGTGCGCCTGCCATGCGCGGCAAGGGAACGTTTCCTGTCCGCTGATTGCGTCGCTGCAAG
GGAAGAAAGAACCGCGCAGTACCGACGCGGAGTAG

Protein sequence :
MECNLMNLTIGAFAKAAEVNVETIRFYQRKGLLCEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLDDGT
HCEEAGSLAEHKLQDVREKMADLARMETVLSKLVCACHARQGNVSCPLIASLQGKKEPRSTDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-53 92
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-53 92
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-53 92
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-53 92
merR AGK07025.1 MerR Not tested SGI1 Protein 6e-53 92
merR AGK07083.1 MerR Not tested SGI1 Protein 6e-53 92
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-53 89
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-53 89
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-46 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-44 74
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-27 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0684 Protein 3e-55 93
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0686 Protein 3e-57 92
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0687 Protein 4e-54 92
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0232 Protein 4e-54 92
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0683 Protein 5e-55 92
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0688 Protein 9e-58 89
Rpic_1783 YP_001899353.1 putative transcriptional regulator MerR BAC0689 Protein 9e-52 89