Gene Information

Name : Rpic_1841 (Rpic_1841)
Accession : YP_001899409.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1931392 - 1932078 bp
Length : 687 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rso:RSp0655 probable two component response regulator transcription regulator protein

DNA sequence :
ATGAAGCTCCTTGTTGTCGAAGACGAATCCAAGACCGGCGAATATTTGCAGCAGGGGTTGTCGGAAGCCGGCTTTGTTGT
GGACCTTGCCCGCAATGGCTTGGACGGCCGACATCTTGCAATGACGGGCGACTATGACCTCTTGATTCTTGACGTGATGT
TGCCCGATCTCGAAGGGTGGCAGATCCTGCACGCACTGCGCTCAACTGAACTGGCTGTGCCGGTGCTGTTTCTGACCGCG
CGCGATAGCGTCGCTGATCGGGTCAAGGGCTTGGAGCTGGGCGCGGATGACTACATGGTCAAACCATTTGCATTTGCGGA
ATTGCTCGCGCGTGTTCGAACTCTGCTTCGACGAGGCAGTGCGCCATCGCTTGCAGAACGCATCCAGGTGGCCGACCTGG
TGCTGGATCTGACTCGCCGTCGTGCTTCCCGTGGCGGTCAGCGAATCACGTTGACCAGTAAGGAGTTCTCGCTGCTGGAA
CTGCTAGCCCGCCGTCATGGCGAGGTGTTGCCCCGGTCCCTGATCGCCTCCCAAGTCTGGGACATGAATTTCGACAGCGA
CACTAACGTGATCGACGTCGCCATTCGACGCCTGCGCGCCAAAATCGACGATAACTTCGAACCTAAATTGATCCATACCG
TCCGTGGCATGGGCTATGTCCTCGAAGGTCCGGAGGACGGGGAGTAA

Protein sequence :
MKLLVVEDESKTGEYLQQGLSEAGFVVDLARNGLDGRHLAMTGDYDLLILDVMLPDLEGWQILHALRSTELAVPVLFLTA
RDSVADRVKGLELGADDYMVKPFAFAELLARVRTLLRRGSAPSLAERIQVADLVLDLTRRRASRGGQRITLTSKEFSLLE
LLARRHGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDNFEPKLIHTVRGMGYVLEGPEDGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-61 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-60 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 2e-79 72
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 3e-76 70
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 3e-68 68
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 1e-69 67
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 4e-68 66
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 1e-67 65
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 2e-68 65
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 9e-31 42
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 1e-31 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 8e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 7e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 7e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 6e-33 41
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 6e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 2e-61 61
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 5e-44 47
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 7e-37 47
Rpic_1841 YP_001899409.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 8e-36 41