Gene Information

Name : Rpic_0295 (Rpic_0295)
Accession : YP_001897886.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 313383 - 314111 bp
Length : 729 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pol:Bpro_0543 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACTCTGCCAAACGCGTCCTGCTCGTTGAAGATGACGCACACATCGCGGAATTGCTGCGCATGCACCTCCGGGACGA
GGGTTATGCGGTGGTGCACGCGGCTGACGGCCATGCGGGCCAGCGGGAAATGGAACGGGGCAACTGGGATGCGCTGGTGC
TCGACCTGATGCTGCCTGGCATCGACGGCCTGGAGATTTGCCGCCGCGCGCGGGTGCAGGCCCGCTACACGCCAATCATC
ATCATCAGTGCCCGGTCGACCGAGGTGCACCGCATCTTGGGGCTGGAGCTCGGCGCAGACGACTACCTTGCCAAGCCCTT
CTCGGTGTTGGAGCTGGTGGCGCGCGTGAAGGCACTGATTCGACGTACCGACGCGCTGGCGCGTAACGCGCGCATGGAGT
CGGGTAGCCTCACACTAGGCAATCTTGAGATCGAACCACTAGCGCGCGAGGTGCGCGTCGACGGCAAACCGATCGAACTC
ACGCCGCGCGAGTTCGACCTACTTCATTTCTTCGCACGTCATCCGGGCAAAGTGTTTTCGAGGCTCGACCTGCTCAATCA
AGTCTGGGGCTACCAGCACGACGGCTACGAGCATACGGTTAACACTCACATCAACCGGCTGCGAGCCAAGGTCGAGGTCG
ACCCGGCGCAGCCGCGGCGCATACTCACCGTCTGGGGGCGCGGCTACAAGCTCTCTATCGGGGCAGACGGCAAGGAGGAC
GCAGCATGA

Protein sequence :
MDSAKRVLLVEDDAHIAELLRMHLRDEGYAVVHAADGHAGQREMERGNWDALVLDLMLPGIDGLEICRRARVQARYTPII
IISARSTEVHRILGLELGADDYLAKPFSVLELVARVKALIRRTDALARNARMESGSLTLGNLEIEPLAREVRVDGKPIEL
TPREFDLLHFFARHPGKVFSRLDLLNQVWGYQHDGYEHTVNTHINRLRAKVEVDPAQPRRILTVWGRGYKLSIGADGKED
AA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-73 59
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-74 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 9e-38 46
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 43
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-41 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-41 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-42 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-43 42
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-33 41
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-37 41
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-73 59
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-74 59
Rpic_0295 YP_001897886.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-31 43