Gene Information

Name : insN (ETA_09600)
Accession : YP_001906904.1
Strain : Erwinia tasmaniensis Et1/99
Genome accession: NC_010694
Putative virulence/resistance : Unknown
Product : transposase insN for insertion sequence element IS911
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1073020 - 1073358 bp
Length : 339 bp
Strand : +
Note : silverDB:etchr00951

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGTTCCAATGAAAAGAAGAAATTTTAGTCCTGAATTCAAACGCGACTCCGC
TCAGTTGGTTGTTGATCAAAACTACACCGTCTCTAATGCCGCTAAGGCTATGGATGTCGGTCTTTCCACGATGACTAAAT
GGGTCAGGCAATTGCGTGAAGAGCGTCAGGGTAAAACACCAAAAGCATCTCCGATAACACCGGAACAAATCGAAATACGC
GAGCTGAAGAAAAAGCTACAACGTATTGAAATGGAAAACGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTC
CCTGAACGGTTCTCGATAA

Protein sequence :
MICSPQNNTGVPMKRRNFSPEFKRDSAQLVVDQNYTVSNAAKAMDVGLSTMTKWVRQLREERQGKTPKASPITPEQIEIR
ELKKKLQRIEMENEILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-34 89
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-40 89
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-40 89
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 8e-39 87
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-34 74
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 74
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 74
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 74
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-34 74
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 74
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-34 74
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-34 74
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 66
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-24 61
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-27 60
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-27 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-26 59
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-26 59
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-26 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 3e-22 51
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-21 45
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-20 44
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-13 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 3e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG1485 Protein 3e-40 89
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG1123 Protein 2e-34 74
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG1553 Protein 4e-29 66
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG0784 Protein 9e-27 59
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG1566 Protein 7e-14 44
insN YP_001906904.1 transposase insN for insertion sequence element IS911 VFG1521 Protein 1e-12 41