Gene Information

Name : ETA_24310 (ETA_24310)
Accession : YP_001908354.1
Strain : Erwinia tasmaniensis Et1/99
Genome accession: NC_010694
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2738676 - 2738873 bp
Length : 198 bp
Strand : -
Note : silverDB:etchr02419; phage-related protein (prophage CP4-57 regulatory protein)

DNA sequence :
ATGTCACAAAATCTCATCCGCATGCCGGAAGTTCTCCGGCGCATAGGTCTTGGTAAGGCTTGGGTATATAAACTTATTTC
TCAAGGGATATTCCCAAAACCAGTAAAAATTGGATCACGCTCTATCGCTTTCGTTGAAAGTGAAATAGACGCATGGATTA
ATCAGCGTATCGCAGAGCGTGACGGGGAGGCGGCATAA

Protein sequence :
MSQNLIRMPEVLRRIGLGKAWVYKLISQGIFPKPVKIGSRSIAFVESEIDAWINQRIAERDGEAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 5e-08 46
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-08 46
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 3e-09 45
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 45
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-09 45
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 3e-05 44
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 3e-05 44
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-07 43
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 4e-08 41
unnamed CAA21398.1 - Not tested HPI Protein 6e-08 41
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 1e-07 41
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 9e-08 41
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-07 41
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-07 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ETA_24310 YP_001908354.1 hypothetical protein VFG1480 Protein 2e-08 46
ETA_24310 YP_001908354.1 hypothetical protein VFG1141 Protein 1e-09 45
ETA_24310 YP_001908354.1 hypothetical protein VFG0651 Protein 4e-08 41