Gene Information

Name : Nther_0984 (Nther_0984)
Accession : YP_001917156.1
Strain : Natranaerobius thermophilus JW/NM-WN-LF
Genome accession: NC_010718
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1047557 - 1048297 bp
Length : 741 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: swo:Swol_0951 response regulator receiver protein

DNA sequence :
ATGCATAGAATATTATTAGTCGAGGATGAACACCATATTGCTAAACTAGTTAATCACAACTTAATAAAAGAAGGGTATGA
AGTTGAACATGTAACCCATGGAGATGAAGCTTTTAACAAATATTTTGAAAATGACTATGATTTAATTATTTTAGATCTAA
TGCTTCCTGGTTTAGATGGGCTAGAAGTTTGTAGAAAAATACGTGGTAATTCCTCCCTGCATATTCCAGTTATTATGTTA
ACAGCAAAAAGTGATGAGATTGAAAAAATAGTAGGTTTAGAAATGGGTGCCGATGATTATGTAACTAAACCTTTTAGTCC
TAGAGAGCTGTTAGCTAGAGTAAAAGCTCAATTGCGTGGAAGAACTAAAGAGTTAACAGATGAAAAAAGCCAAGATAATT
CTAACAAGATTTTTGATCAAAGGGATAAAAGTGAAGATGTTAAAAAGAATGGTCCTTTATCAATTAAACCTGAAAAATAT
CGAGCATATATTGAAAATCAAGAATTACAGTTAACTCCAAAAGAATTTGAGCTTTTAAATATTATGGTTACAAACTCTGG
ACAAGTTTTGACGAGAGAAAAATTACTTGAAAAAATTTGGGGCTACGATTTTCTTGGAGATACCAGAACTGTAGATGTTC
ATATTAGACATCTACGCCAGAAAATTAGTGAAGCGGGTGGTCCTCCTGACTTAGTAGAGACAGTCAGGGGCATAGGATAT
CGTTTAAAAGAAATGGAGTAA

Protein sequence :
MHRILLVEDEHHIAKLVNHNLIKEGYEVEHVTHGDEAFNKYFENDYDLIILDLMLPGLDGLEVCRKIRGNSSLHIPVIML
TAKSDEIEKIVGLEMGADDYVTKPFSPRELLARVKAQLRGRTKELTDEKSQDNSNKIFDQRDKSEDVKKNGPLSIKPEKY
RAYIENQELQLTPKEFELLNIMVTNSGQVLTREKLLEKIWGYDFLGDTRTVDVHIRHLRQKISEAGGPPDLVETVRGIGY
RLKEME

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-42 45
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-43 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-52 49
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-50 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 7e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 8e-52 47
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 6e-51 46
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 9e-43 45
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 9e-43 45
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 2e-43 43
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 2e-43 43
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 2e-43 43
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-51 43
Nther_0984 YP_001917156.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 5e-40 42