Gene Information

Name : BMULJ_06267 (BMULJ_06267)
Accession : YP_001942044.1
Strain :
Genome accession: NC_010802
Putative virulence/resistance : Virulence
Product : OmpR family two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 118330 - 119001 bp
Length : 672 bp
Strand : -
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Ralstonia solanacearum; KEGG, K02483

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAACCGAAAATGGCGTCATATCTCCGAAAGGGACTGACGGAAGCGAGCTATACCGT
CGATGTTGCCGAGAACGGCAAAATCGGATTGTTTCTCGCGCTGCATGAAAATTTTGACCTCGTCGTGCTCGACGTCATGC
TCCCGGAGCTGGACGGGTTCGAGGTGCTGAAGCGCCTCCGCGCGGAAAAGCAGACACCCGTGCTGATGCTGACCGCCCGC
GAAGCAATCGAGGACAAGGTCGCTGGGCTTGAACTTGGTGCAGACGACTATCTACACAAACCGTTCGCCTACGCGGAATT
TCTCGCACGCATCCGTTCGTTGCTACGGCGCGCACCGCGGAGCATTCGGGACATTCTGCTCGTTGCGGACATGGAGATTG
ACCTCCTCAAGCGGCGAGTGCGTCGCGGCGACAATCGCATCGACCTGACCGCACAGGAGTTCGCATTGTTGCAACTCCTG
GCTGAACGAGAGGGCGAGGTTTTGACGCGTACTTTCATTACCTCGCAGATCTGGGATATGAATTTCGATAGCGATACGAA
CGTGGTCGATGCCGCGATCAAGCGCCTGCGCGCCAAAGTCGACAACGCGTACGATAAGAAACTGATCCATACCATCCGGG
GCATGGGATACGTGCTCGAGGACCGTTCATGA

Protein sequence :
MRILIVEDEPKMASYLRKGLTEASYTVDVAENGKIGLFLALHENFDLVVLDVMLPELDGFEVLKRLRAEKQTPVLMLTAR
EAIEDKVAGLELGADDYLHKPFAYAEFLARIRSLLRRAPRSIRDILLVADMEIDLLKRRVRRGDNRIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKVDNAYDKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-50 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-49 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0197 Protein 7e-56 61
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0638 Protein 6e-56 60
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0125 Protein 2e-56 59
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0083 Protein 3e-56 57
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0111 Protein 6e-54 55
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0308 Protein 8e-51 54
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator BAC0347 Protein 2e-48 54
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_010079.5776364.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_002952.2859858.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_007622.3794948.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_003923.1003417.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_013450.8614146.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_002951.3238224.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_007793.3914065.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator NC_002758.1121390.p0 Protein 8e-33 45
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator AE015929.1.gene1106. Protein 6e-29 44
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator HE999704.1.gene1528. Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator VFG0596 Protein 1e-50 53
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator VFG1390 Protein 6e-35 43
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator VFG1389 Protein 4e-28 43
BMULJ_06267 YP_001942044.1 OmpR family two-component system response regulator VFG1386 Protein 2e-32 41