Gene Information

Name : BMULJ_01571 (BMULJ_01571)
Accession : YP_001946032.1
Strain :
Genome accession: NC_010804
Putative virulence/resistance : Resistance
Product : SMR family small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1680967 - 1681305 bp
Length : 339 bp
Strand : +
Note : COG2076: Membrane transporters of cations and cationic drugs, Brucella melitensis; KEGG, K03297

DNA sequence :
ATGCAGCTGCCCGGATACGCCTGGCTCGCGATCGCGATCGTCGCGGAAGTGATCGGCACGTCGGCGCTGCGCGCGGCGGA
CGGCTTCACGCGCTTCTGGCCGTCTGCGCTCGTCGTGGCCGGTTACGGCGTCGCGTTCTACTGCCTGTCGCTGACCTTGC
GCACGATGCCGGTCGGCATCATCTATGCGGTGTGGTCGGGCGCGGGCATCGTGCTGATCACGCTCGTCGCGATGCTGCTG
TACCGTCAGGTGCCCGACCTGCCGGCGGTGATCGGCCTCGGCCTGATCATCTCGGGCGTCGTGGTGCTGAACCTGTTCTC
GAAGATGCAGGCGCACTGA

Protein sequence :
MQLPGYAWLAIAIVAEVIGTSALRAADGFTRFWPSALVVAGYGVAFYCLSLTLRTMPVGIIYAVWSGAGIVLITLVAMLL
YRQVPDLPAVIGLGLIISGVVVLNLFSKMQAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 7e-17 58
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 7e-17 58
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 7e-17 58
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 7e-17 58
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 7e-17 58
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 7e-17 58
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 7e-17 58
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 7e-17 58
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-16 58
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 7e-17 58
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-17 58
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-16 58
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-17 58
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-16 58
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-17 58
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-16 58
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 7e-17 58
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 7e-17 58
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 7e-17 58
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-16 58
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 7e-23 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0322 Protein 1e-21 61
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0324 Protein 8e-21 60
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein NC_010410.6003348.p0 Protein 8e-22 59
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0002 Protein 8e-22 59
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0323 Protein 3e-17 58
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0377 Protein 1e-25 56
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein CP001138.1.gene1489. Protein 1e-20 56
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein CP004022.1.gene1549. Protein 3e-21 50
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein NC_002695.1.913273.p Protein 1e-16 49
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0139 Protein 3e-16 48
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0150 Protein 1e-16 47
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0140 Protein 2e-16 47
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0192 Protein 2e-16 44
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0329 Protein 2e-14 42
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0325 Protein 3e-15 41
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein BAC0327 Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_01571 YP_001946032.1 SMR family small multidrug resistance protein VFG1586 Protein 3e-23 47