Name : rpmE2 (BMULJ_01803) Accession : YP_001946259.1 Strain : Genome accession: NC_010804 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 1938835 - 1939098 bp Length : 264 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACCTGGCATTCACCCGGATTACCGCGAAGTCGTCTTCCAAGACATGTCGAACGGCTTCAAGTTCATCACGCGTTC GACGATCCAGACGCGCGAAACCATCGAGCTCGAAGGCAAGACCTACCCGCTCGCGAAGATCGAAGTCTCGTCGGAATCGC ACTCGTTCTACACGGGTCAGCAAAAGATCATGGACACGGCCGGCCGCGTCGAGAAGTTCAAGAACAAGTTCGGTTCGCGC GCAAGCGGCAAGGTCGCGAAGTAA Protein sequence : MKPGIHPDYREVVFQDMSNGFKFITRSTIQTRETIELEGKTYPLAKIEVSSESHSFYTGQQKIMDTAGRVEKFKNKFGSR ASGKVAK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-14 | 52 |
rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-14 | 52 |