
|
Name : cusR (BMULJ_00904) Accession : YP_001945393.1 Strain : Genome accession: NC_010804 Putative virulence/resistance : Virulence Product : two-component system copper resistance phosphate regulon response regulator Function : - COG functional category : T : Signal transduction mechanisms COG ID : COG0745 EC number : - Position : 977762 - 978445 bp Length : 684 bp Strand : + Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Ralstonia solanacearum; CusR protein; KEGG, K07665 DNA sequence : ATGAAACTGTTGGTGATCGAGGACGAGAACAAGACAGCGGACTACGTGCGCCAGGGCCTCATGGAAGCGGGGTTCGTGGT GGACCTGGCACGCAATGGCCTGGACGGCCATCACCAGGCCATGAGCGAGACCTACGATCTGGTCATCCTCGACGTCATGC TGCCGGACGTGGATGGCTGGCGCATCGTTCAATCGCTGCGCGAGGCGGGCAAGCAGGTCCCGGTGCTGTTCCTGACCGCG CGCGGCGGCGTGGATGACCGCGTGAAGGGCCTGGAACTGGGCGCCGACGACTACCTGGTCAAGCCTTTCGCGTTCTCCGA GTTGCTCGCGCGCGTGCGCACGCTGCTGCGCCGCGGCAGCGCGCCCAACCACCCCGACCGCATCCAGATCGCCGATCTGC TGCTCGACCTGCCGCGGCGGCGCGCGACCCGGGCAGGACAGCGCATCAACCTAACCAGCAAGGAGTTCGCCTTGCTCGAA CTGCTGGCGCGGCGCCAGGGCGAGGTGTTGCCGCGCTCATTGATCGCCTCGCAGGTCTGGGACATGAATTTCGACAGCGA CAGCAACGTGATCGACGTTGCCATTCGCCGGCTGCGCGCGAAGATCGACGATGCCTTCGATCCCAAGCTCATCCATACGG TACGGGGCATGGGCTATACGCTGGATGCCCCGGATGCCGACTAA Protein sequence : MKLLVIEDENKTADYVRQGLMEAGFVVDLARNGLDGHHQAMSETYDLVILDVMLPDVDGWRIVQSLREAGKQVPVLFLTA RGGVDDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGSAPNHPDRIQIADLLLDLPRRRATRAGQRINLTSKEFALLE LLARRQGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDAFDPKLIHTVRGMGYTLDAPDAD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| copR | NP_460069.2 | transcriptional regulatory protein YedW | Not tested | SPI-5 | Protein | 4e-57 | 58 |
| copR | AAC33719.1 | regulatory protein CopR | Not tested | SPI-5 | Protein | 3e-56 | 56 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0083 | Protein | 2e-69 | 72 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0111 | Protein | 4e-72 | 69 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0638 | Protein | 1e-62 | 69 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0197 | Protein | 5e-62 | 65 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0347 | Protein | 6e-63 | 64 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0125 | Protein | 1e-60 | 62 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | BAC0308 | Protein | 2e-62 | 61 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | NC_002516.2.879194.p | Protein | 4e-26 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | VFG0596 | Protein | 1e-57 | 58 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | VFG1389 | Protein | 3e-34 | 45 |
| cusR | YP_001945393.1 | two-component system copper resistance phosphate regulon response regulator | VFG1390 | Protein | 8e-39 | 43 |