Gene Information

Name : Cphamn1_0990 (Cphamn1_0990)
Accession : YP_001959414.1
Strain : Chlorobium phaeobacteroides BS1
Genome accession: NC_010831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1064535 - 1065203 bp
Length : 669 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cch:Cag_0440 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATTCTCATTATTGAAGATGAATCGGGGATAGCCGATTTTCTCAGGGAAGGCCTTGAAGAGGAATGCTTTGCGGT
CGATGTTGCACATAACGGTCGTGAAGGGCTGTCGATGGCGCTGATTAATGAGTACGATCTGCTCATTGTAGACTGGCTTC
TTCCTGGCCTGAGCGGTGTGGAGGTGTGCCGGCAGTTCCGGAAAGAACACGCTCAGGTGCCGGTCATATTCCTTACGGCG
AAAGGTGACCTCGATGACGTGATTTTCGGCCTCGAGTCGGGCGCCAACGATTATATGAAAAAGCCTTTTGCATTTGAAGA
ACTTCTGGCGCGAATCAGGGTGCAACTGAGGCTTTCCGGATCGGAAACCGTGATGATGCAGGCAGGCGGTGTTGAAATGA
ATCTTGCCGCTCACAGGGTTACCTGTAACGGGAAGGATGTCTCACTGACTCCCAAGGAGTTCGCACTGCTGGAGTACCTG
TTGCGCAACAGGGGAAGTGTCTGTACCAGAAGCAGGATCATCGAGCATGTCTGGGACATCCATTTTGATGCCGACACATC
GGTGATCGATGTGTATGTCAACTTTCTGAGGAAAAAGCTCGATGGGGCGGGTTGCGGCGCGCTTATCGAAACGGTAAGGG
GCGTAGGATATGTTATTCGGGGAGAGTAG

Protein sequence :
MRILIIEDESGIADFLREGLEEECFAVDVAHNGREGLSMALINEYDLLIVDWLLPGLSGVEVCRQFRKEHAQVPVIFLTA
KGDLDDVIFGLESGANDYMKKPFAFEELLARIRVQLRLSGSETVMMQAGGVEMNLAAHRVTCNGKDVSLTPKEFALLEYL
LRNRGSVCTRSRIIEHVWDIHFDADTSVIDVYVNFLRKKLDGAGCGALIETVRGVGYVIRGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-41 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-39 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-37 48
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-42 46
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-44 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-41 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-38 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-39 45
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-39 44
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0111 Protein 7e-44 44
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-36 43
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-41 46
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-43 42
Cphamn1_0990 YP_001959414.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-34 41