Gene Information

Name : Smlt4209 (Smlt4209)
Accession : YP_001973883.1
Strain : Stenotrophomonas maltophilia K279a
Genome accession: NC_010943
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4324091 - 4324798 bp
Length : 708 bp
Strand : -
Note : similarity:fasta; BAV2783; bavium; osmolarity two component response regulator; length 233 aa; id=45.1%; E()=2e-28; 233 aa overlap; query 1-228 aa; subject 1-231 aa

DNA sequence :
ATGACAACTCCCGCCCGTGTCATCGTTGTCGATGACGACGCCAGCATCCGTGATGCCATCGCCGATTGCCTGTTGCTGCA
TGGCTACCAGGTACGGGTGGCAGCGGACGCGACGGCGCTGGACGTGCTGCTGCAGGTCGATCGCCCGGACGTGATCATCC
TCGACTGGATGATGCCCGGTGAGGATGGCCTGTCGGTCTGCCGCCGGCTGCAGGCACGGGCCATTCCGATCCTGATGCTG
TCGGCGATGGGCAGCGCACCGGACAGGGTGATCGGCCTGGAGATGGGCGCGGACGACTACCTGGCCAAGCCGTTCGACCC
GCGCGAGCTGCTGGCGCGGGTAGGCGCGCTGCTGCGCCGGCAGGACAAGCTGCGCGCGCGGGTAGCCAGTGAACTGCGCT
TTTCTGGTTGGCGGTTGCTGCCGGAACAACGTCGCCTGCTGGCGCCGGATGGGAACGAGCTGGTGCTCAGCCGTGGTGAA
TTCAGCCTGTTGCTGGCGCTGGCCGAACGCCCCGGGCGGGTGCTGGGGCGCGAGCAGCTGCTGCAGCTGAGCCGTGGCGA
ACCGAGTGACAGCGTCGACCGCGCGGTCGACCTGGCGATCAGCCGCCTGCGCCGCAAGCTCGGGCAGGCCTCACCCGGTG
CGGAAGCCCTGGTGCAGACATCGCGTGGCGAAGGCTATCGCTTCCACGCCGAGGTACAGGTGCTGTGA

Protein sequence :
MTTPARVIVVDDDASIRDAIADCLLLHGYQVRVAADATALDVLLQVDRPDVIILDWMMPGEDGLSVCRRLQARAIPILML
SAMGSAPDRVIGLEMGADDYLAKPFDPRELLARVGALLRRQDKLRARVASELRFSGWRLLPEQRRLLAPDGNELVLSRGE
FSLLLALAERPGRVLGREQLLQLSRGEPSDSVDRAVDLAISRLRRKLGQASPGAEALVQTSRGEGYRFHAEVQVL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smlt4209 YP_001973883.1 two component response regulator NC_008702.1.4607594. Protein 9e-39 48
Smlt4209 YP_001973883.1 two component response regulator CP001918.1.gene5135. Protein 9e-22 43
Smlt4209 YP_001973883.1 two component response regulator CP004022.1.gene3215. Protein 3e-21 43
Smlt4209 YP_001973883.1 two component response regulator BAC0197 Protein 2e-19 43
Smlt4209 YP_001973883.1 two component response regulator CP000647.1.gene4257. Protein 2e-21 43
Smlt4209 YP_001973883.1 two component response regulator CP001138.1.gene4273. Protein 2e-21 43
Smlt4209 YP_001973883.1 two component response regulator NC_002695.1.915041.p Protein 3e-21 43
Smlt4209 YP_001973883.1 two component response regulator BAC0533 Protein 2e-21 43
Smlt4209 YP_001973883.1 two component response regulator CP000034.1.gene3834. Protein 3e-21 43
Smlt4209 YP_001973883.1 two component response regulator CP001485.1.gene721.p Protein 2e-23 42
Smlt4209 YP_001973883.1 two component response regulator CP000034.1.gene3671. Protein 3e-33 41
Smlt4209 YP_001973883.1 two component response regulator NC_002952.2859905.p0 Protein 3e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_002758.1121668.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_009641.5332272.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_013450.8614421.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_007793.3914279.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_007622.3794472.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_003923.1003749.p0 Protein 3e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_002745.1124361.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_009782.5559369.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator NC_002951.3237708.p0 Protein 4e-28 41
Smlt4209 YP_001973883.1 two component response regulator BAC0083 Protein 5e-20 41
Smlt4209 YP_001973883.1 two component response regulator NC_012469.1.7686381. Protein 7e-27 41
Smlt4209 YP_001973883.1 two component response regulator AF155139.2.orf0.gene Protein 3e-25 41
Smlt4209 YP_001973883.1 two component response regulator NC_012469.1.7685629. Protein 8e-26 41
Smlt4209 YP_001973883.1 two component response regulator AE000516.2.gene3505. Protein 7e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smlt4209 YP_001973883.1 two component response regulator VFG1390 Protein 4e-25 41
Smlt4209 YP_001973883.1 two component response regulator VFG1389 Protein 1e-21 41
Smlt4209 YP_001973883.1 two component response regulator VFG0596 Protein 3e-18 41