Gene Information

Name : phoB (RHECIAT_CH0000589)
Accession : YP_001976759.1
Strain : Rhizobium etli CIAT 652
Genome accession: NC_010994
Putative virulence/resistance : Virulence
Product : phosphate regulon, two-component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 585764 - 586447 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGATCCCGAGAGTTGCAGTTGTTGAAGACGAAGAGGCCCTCAGCGTGCTTCTCCGCTATAATCTCGAAGCGGAAGGTTT
CGAGGTCGATACCATCCTGCGCGGCGACGAGGCCGAAATCAGGCTTCAGGAGCGCACGCCCGATCTCCTCATCCTCGACT
GGATGCTGCCCGGCGTCTCCGGCATCGAACTCTGCCGGCGCCTGCGCATGCGGCCGGAAACCGAGCGGCTGCCGATCATC
ATGCTGACGGCGCGCGGCGAAGAGAGCGAGCGTGTGCGCGGGCTGTCCACCGGCGCCGACGATTACGTCGTCAAGCCGTT
CTCGACCCCCGAGCTCGTCGCCCGCGTCAAGGCGATGCTGCGCCGCGCCCGCCCGGAGGTGCTGTCCTCGGTGCTGAAAT
GCGGCGATATCGAGCTTGACCGCGAAACCCACCGCGTCCATCGCAAGAGCCGCGAAGTCCGCCTCGGCCCGACCGAATTC
CGCCTGTTGGAATTCCTGATGTCGTCGCCGGGCCGCGTCTTCTCCCGCTCGCAGCTGCTCGACGGCGTCTGGGGCCACGA
CATTTATGTCGACGAACGCACCGTCGACGTCCATGTCGGCCGCCTGCGCAAGGCGCTGAACTTCTCCAACATGCAGGACG
TCATCCGCACCGTCCGCGGCGCCGGCTATTCGATGGAAGCCTGA

Protein sequence :
MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERTPDLLILDWMLPGVSGIELCRRLRMRPETERLPII
MLTARGEESERVRGLSTGADDYVVKPFSTPELVARVKAMLRRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEF
RLLEFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAGYSMEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-27 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-27 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-27 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-27 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein AE000516.2.gene3505. Protein 1e-33 44
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein HE999704.1.gene2815. Protein 3e-39 43
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_011595.7057856.p0 Protein 7e-36 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_010410.6002989.p0 Protein 7e-36 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_010400.5986590.p0 Protein 7e-35 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_002952.2859905.p0 Protein 8e-42 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_013450.8614421.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_007793.3914279.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_003923.1003749.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_002745.1124361.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_009782.5559369.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_002951.3237708.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_007622.3794472.p0 Protein 8e-42 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_002758.1121668.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_009641.5332272.p0 Protein 1e-41 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein CP001918.1.gene3444. Protein 1e-33 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein CP001138.1.gene2239. Protein 7e-32 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein CP000034.1.gene2186. Protein 7e-33 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein NC_002695.1.916589.p Protein 6e-33 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein BAC0596 Protein 7e-32 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein BAC0039 Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein VFG1390 Protein 7e-36 42
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein VFG1563 Protein 3e-34 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein VFG1702 Protein 4e-34 41
phoB YP_001976759.1 phosphate regulon, two-component response regulator protein VFG1386 Protein 3e-31 41