Gene Information

Name : irlR (BCAM0443)
Accession : YP_002233069.1
Strain :
Genome accession: NC_011001
Putative virulence/resistance : Virulence
Product : two-component regulatory system response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 498585 - 499256 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAAGCCAAGATGGCGTCCTACCTGCGGAAGGGCCTGACGGAGGCGAGCTACACGGT
CGACGTCGCGGAAAACGGCAAGGACGGGCTGTTCCTCGCATTGCACGAGGATTTCGACCTGGTCGTGCTCGACGTGATGC
TGCCGGAGCTCGACGGCTTCGAGGTGCTCAGGCGGCTGCGCGCGCAGAAGCAGACGCCCGTGCTGCTGCTCACGGCCCGC
GACGCGATCGAGGACAAGGTCGCCGGGCTCGAACTCGGCGCCGACGATTACCTGCTCAAGCCGTTCGCGTATGCCGAATT
CCTCGCCCGTATCCGCTCGCTGCTGCGGCGCGCGCCGCGCAATGTGCGCGACATCCTGCACGTCGCCGATCTGGAAATCG
ACCTGCTCAAGCGCCGCGTGCGGCGCGCCGACGCCCGCATCGACCTGACCGCACAGGAATTCGCGCTGCTGCAACTGCTC
GCGGAACGCGAAGGCGAGGTGCTGACGCGCACCTTCATCACGTCGCAGATCTGGGACATGAATTTCGACAGCGACACGAA
CGTCGTCGATGCGGCGATCAAGCGCCTGCGCGCGAAGATCGACAACGCTTACGAGAAGAAGCTGATCCACACGATCCGCG
GCATGGGCTACGTGCTCGAGGATCGTTCGTGA

Protein sequence :
MRILIVEDEAKMASYLRKGLTEASYTVDVAENGKDGLFLALHEDFDLVVLDVMLPELDGFEVLRRLRAQKQTPVLLLTAR
DAIEDKVAGLELGADDYLLKPFAYAEFLARIRSLLRRAPRNVRDILHVADLEIDLLKRRVRRADARIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNAYEKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-50 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0197 Protein 1e-56 63
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0638 Protein 4e-57 62
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0083 Protein 2e-57 59
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0125 Protein 9e-58 59
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0111 Protein 2e-56 58
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0308 Protein 8e-52 55
irlR YP_002233069.1 two-component regulatory system response regulator protein BAC0347 Protein 5e-50 55
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_007793.3914065.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_002758.1121390.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_010079.5776364.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_002952.2859858.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_007622.3794948.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_003923.1003417.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_013450.8614146.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein NC_002951.3238224.p0 Protein 6e-35 46
irlR YP_002233069.1 two-component regulatory system response regulator protein AE015929.1.gene1106. Protein 5e-29 44
irlR YP_002233069.1 two-component regulatory system response regulator protein HE999704.1.gene1528. Protein 2e-31 43
irlR YP_002233069.1 two-component regulatory system response regulator protein HE999704.1.gene2815. Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_002233069.1 two-component regulatory system response regulator protein VFG0596 Protein 2e-51 55
irlR YP_002233069.1 two-component regulatory system response regulator protein VFG1386 Protein 3e-33 45
irlR YP_002233069.1 two-component regulatory system response regulator protein VFG1390 Protein 3e-35 44
irlR YP_002233069.1 two-component regulatory system response regulator protein VFG1389 Protein 4e-29 43