Gene Information

Name : BCAS0586 (BCAS0586)
Accession : YP_002153970.1
Strain :
Genome accession: NC_011002
Putative virulence/resistance : Virulence
Product : two-component regulatory system, response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 640811 - 641488 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGCGCATCCTGATAGTCGAAGACGAACCGAAGACGGGCGCGTACCTGAAGAAGGGGCTCGAGGAATCGGGTTTCAGCGT
CGATCTCGCGAAGGACGGCGGCGAAGGGCTGATGCTCGCGCAGGAAGAGCGTTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGTGCTCGACGGCTGGGGCGTGCTCAAGCGGCTGCGCGACACGCACACGACGCCGGTGCTGTTCCTGACCGCGCGC
GACGACGTGCAGGACCGCGTGCACGGCCTCGAACTCGGCGCGGACGACTACCTCGTGAAGCCGTTCGCGTTCGTCGAGCT
GCTCGCCCGGATCCGCACGCTCGCGCGTCGCGGGCCGCCGCGCGAGACCGAGCATCTGGCGGTCGGCGATCTGGACATCG
ACGTGGTGCGCCGCCGCGTGAAGCGCGGCGCCACGCGGATCGACCTGACGCCGCGGGAATTCTCGCTGCTGCAGCTGCTC
GCGCGCCGCCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCGTCGTACGTGTGGGACATGAATTTCGACAGCGACACCAA
CGTCGTCGAGGTCGCGATCCGGCGCCTGCGCGCGAAGATCGACGACGCGTTCCCGGTCAAGCTGATCCATACCGTGCGCG
GCGTCGGCTACGTGCTCGAACCGAAGGACGACGCATGA

Protein sequence :
MRILIVEDEPKTGAYLKKGLEESGFSVDLAKDGGEGLMLAQEERYDVIVLDVMLPVLDGWGVLKRLRDTHTTPVLFLTAR
DDVQDRVHGLELGADDYLVKPFAFVELLARIRTLARRGPPRETEHLAVGDLDIDVVRRRVKRGATRIDLTPREFSLLQLL
ARRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIHTVRGVGYVLEPKDDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-56 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0125 Protein 6e-73 69
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0197 Protein 5e-70 65
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0083 Protein 3e-69 63
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0638 Protein 2e-60 61
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0111 Protein 1e-63 59
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0308 Protein 3e-65 59
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein BAC0347 Protein 2e-58 56
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002952.2859905.p0 Protein 3e-34 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_007793.3914065.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002758.1121390.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_010079.5776364.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002952.2859858.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_007622.3794948.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_003923.1003417.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_013450.8614146.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002951.3238224.p0 Protein 2e-38 44
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002758.1121668.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_009641.5332272.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_013450.8614421.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_007793.3914279.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_003923.1003749.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_007622.3794472.p0 Protein 3e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002745.1124361.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_009782.5559369.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_002951.3237708.p0 Protein 4e-34 43
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein AE015929.1.gene1106. Protein 2e-32 42
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein HE999704.1.gene1528. Protein 1e-30 42
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein HE999704.1.gene2815. Protein 1e-32 42
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein AE000516.2.gene3505. Protein 6e-30 42
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein NC_012469.1.7685629. Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein VFG0596 Protein 5e-58 57
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein VFG1389 Protein 1e-40 50
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein VFG1390 Protein 2e-42 48
BCAS0586 YP_002153970.1 two-component regulatory system, response regulator protein VFG1386 Protein 3e-38 44