Gene Information

Name : BCAS0620 (BCAS0620)
Accession : YP_002154002.1
Strain :
Genome accession: NC_011002
Putative virulence/resistance : Virulence
Product : two-component regulatory system, response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 679911 - 680630 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGGACCAACCGAAACGTATCCTGATCGTCGAGGACGATGCCGACATCGCCGACGTGCTGAGCCTGCACCTGCGCGACGA
GCGCTACGAAGTCGTGCACAGCGCGGACGGCGCCGAAGGGCTGCGCCTGCTCGAACAGGGCGGCTGGGACGCGCTGATCC
TGGACCTGATGCTGCCGGGCGTCGACGGCCTCGAGATCTGTCGGCGGGCGCGCGCGATGACGCGCTACACGCCGATCATC
ATCACGAGCGCGCGATCGAGCGAGGTGCACAGGATCCTCGGCCTCGAACTCGGCGCCGACGACTACCTCGCGAAGCCGTT
CTCGGTGCTCGAACTCGTCGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGATGCGCTCGCGCGCGATTCGCGGCTCGACG
CGGGCACGCTCGACGTCGCCGGGCTGGCGATCGACCCGATCGCGCGCGAAGCGAGCGTCGACGGCGCACGCATCGACCTC
ACGCCGCGCGAATTCGACCTGCTGTATTTCTTCGCGCGGCATCCGGGCAAGGTGTTCTCGCGGATGGACCTGCTCAATGC
GGTGTGGGGCTATCAGCACGAAGGCTACGAACATACGGTCAACACCCACATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCGGCCGAGCCCGTGCGAATCCTCACCGTGTGGGGGCGCGGCTACAAGCTCGCCGCGCCGGGTCAGCGGGACGCATGA

Protein sequence :
MDQPKRILIVEDDADIADVLSLHLRDERYEVVHSADGAEGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVDALARDSRLDAGTLDVAGLAIDPIAREASVDGARIDL
TPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPGQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-72 63
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-71 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein AE000516.2.gene3505. Protein 4e-38 46
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_012469.1.7685629. Protein 2e-42 46
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_003923.1003417.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_013450.8614146.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_002951.3238224.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_007793.3914065.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_002758.1121390.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_010079.5776364.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_002952.2859858.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_007622.3794948.p0 Protein 8e-36 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein AE015929.1.gene1106. Protein 1e-30 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein AF155139.2.orf0.gene Protein 5e-42 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein HE999704.1.gene1528. Protein 2e-34 43
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein HE999704.1.gene2815. Protein 8e-41 42
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein CP001918.1.gene3444. Protein 6e-31 42
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein FJ349556.1.orf0.gene Protein 9e-39 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein AE016830.1.gene1681. Protein 2e-42 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_012469.1.7686381. Protein 1e-38 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein CP001138.1.gene2239. Protein 1e-30 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein CP000034.1.gene2186. Protein 1e-31 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein NC_002695.1.916589.p Protein 1e-31 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein BAC0596 Protein 1e-30 41
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein BAC0039 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein VFG1563 Protein 5e-72 63
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein VFG1702 Protein 5e-72 63
BCAS0620 YP_002154002.1 two-component regulatory system, response regulator protein VFG1389 Protein 3e-31 46