Gene Information

Name : Rpal_5261 (Rpal_5261)
Accession : YP_001994223.1
Strain : Rhodopseudomonas palustris TIE-1
Genome accession: NC_011004
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5674963 - 5675676 bp
Length : 714 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bra:BRADO1679 response regulator in two-component regulatory system with PhoR (or CreC), regulation of P

DNA sequence :
ATGGCTGCGCGCATTCTGGTAGTTGAAGACGAGGAAGCGCTGACGACGCTGCTGCGATACAATCTGGAATCCGAGGGCTA
CGAGGTCGAGACGGTGGCCCGCGGCGACGATGCCGACACCCGGATGAAAGAGCGCATTCCCGATCTGGTGGTGTTGGACT
GGATGTTGCCGGGCCTGTCCGGCATCGAGCTGTGCCGCCGGCTGCGGGCGCGGCCGGAAACCAAGCAACTGCCGATCATC
ATGCTGACGGCGCGCGGCGAAGAGAGCGAACGCGTTCGCGGCCTCGCGACCGGGGCCGACGATTACATCGTCAAGCCGTT
CTCGGTGCCGGAGCTGCTGGCGCGGGTGAAGGGCCTGCTCCGCCGCGCGGCGCCGGAGCGGCTCGCCACCGTGCTGGCCT
ATGGCGATCTCGAACTCGATCGCGACAAGCGCCGGGTGGCGCGCTCCGGCCGGCCGATCGATCTCGGCCCGACCGAGTAT
CGCTTGCTCGAGTTTTTCCTGGAGCATCCGGGCCGGGTGTTCAGCCGCGAACAGTTGCTCGACGGCGTCTGGGGCCGCGA
CATCTATATCGATGAGCGGACCGTCGACGTGCACATCGGGCGTCTGCGCAAGCTGCTCAATATCGGCCGCGAGCAGGATC
CGATCCGCACCGTCCGCGGTGCCGGCTACGCCCTCGACGACCGCTTTGCCAAGGTTGAAGGCAGCCCGTCGTAG

Protein sequence :
MAARILVVEDEEALTTLLRYNLESEGYEVETVARGDDADTRMKERIPDLVVLDWMLPGLSGIELCRRLRARPETKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRAAPERLATVLAYGDLELDRDKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDGVWGRDIYIDERTVDVHIGRLRKLLNIGREQDPIRTVRGAGYALDDRFAKVEGSPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-35 44
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-37 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-37 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-34 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator BAC0596 Protein 9e-35 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-35 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 6e-35 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 9e-35 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-35 43
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 9e-37 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-38 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-41 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-35 42
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-30 41
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-34 41
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-39 45
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-35 44
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-35 44
Rpal_5261 YP_001994223.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-30 42