Gene Information

Name : Cpar_1213 (Cpar_1213)
Accession : YP_001998818.1
Strain : Chlorobaculum parvum NCIB 8327
Genome accession: NC_011027
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1326002 - 1326685 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cph:Cpha266_1205 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAGACTGCTGATTATCGAAGATGAACCGGGAATCGCGGGCTTTCTGAAGGAGGGCCTTGAAGAAGAGTACTTTGCGGT
CGATGTCGCCAGCGACGGCCGCACGGGGCTCGACCTTGCCATGACCAACGAGTACGATCTTTTGCTCGTGGACTGGATGA
TTCCCGGCATCAGCGGTATCGAGGTGTGTCGGAGACTGCGCAAGGAGGGCAACGATGTGCCGATCATTTTCCTGACGGCA
AAGGACACCATCGAGGATGTTGTGTTCGGTCTCGATGCAGGCGCGAACGACTACATCCGCAAGCCCTTTGAATTCGAGGA
GCTGCTGGCTCGCATCCGTGTGCAGTTGCGACGGCGGGGCAGCGAAAGTTCCAAGCTGAGCACCGGTGAACTGACGGTCG
ATCCCGCTTCCCATCAGGCCCGGTGTGAGTCTATCGATCTGGCCCTTACGCCAAAAGAGTTCGCGCTGCTCGAATTTCTT
TTGCGTAACAAGGGGCGGGTCTGCACCCGGAGCCGCATCATCGAGCATGTGTGGGACATGCACTTCGATTCCGACACCTC
GGTGATCGACGTCTACATCAACTTCCTTCGCAAAAAGCTTGATGCGGCCGGATGCCGTGATCTCATCCAGACCATCCGCG
GCGTGGGCTACATCATTCGCGACGAGGGCGGAGAGGCGCAATGA

Protein sequence :
MRLLIIEDEPGIAGFLKEGLEEEYFAVDVASDGRTGLDLAMTNEYDLLLVDWMIPGISGIEVCRRLRKEGNDVPIIFLTA
KDTIEDVVFGLDAGANDYIRKPFEFEELLARIRVQLRRRGSESSKLSTGELTVDPASHQARCESIDLALTPKEFALLEFL
LRNKGRVCTRSRIIEHVWDMHFDSDTSVIDVYINFLRKKLDAAGCRDLIQTIRGVGYIIRDEGGEAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-40 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-45 47
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-43 47
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-41 47
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0638 Protein 9e-37 45
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-38 45
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-43 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-39 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-40 43
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-39 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-45 44
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-40 42
Cpar_1213 YP_001998818.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-36 42