Gene Information

Name : Smal_2165 (Smal_2165)
Accession : YP_002028552.1
Strain : Stenotrophomonas maltophilia R551-3
Genome accession: NC_011071
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2425751 - 2426449 bp
Length : 699 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rso:RSp0655 probable two component response regulator transcription regulator protein

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACGAACCCAAGACCGGCAACTACCTGCGCCAGGGCCTGATCGAGGCCGGCTATGTGGT
CGACCTCGCCAGCAACGGCATCGACGGCCTGCATCTGGCCGAGAGTGGCGAGTACCAGCTGGTCATCCTCGATGTGATGC
TGCCCGGCCTGGATGGCTGGACCGTGCTGTCGCGGCTGCGTGGAGCCGGCTGGCCGCTGCCGGTGCTGTTCCTGACCGCG
CGCAGCAGCATCGCCGACCGCGTGCAGGGCCTGGAGCTGGGCGCCGATGACTACCTGGCCAAGCCCTTCGCTTTCGCCGA
GCTGCTGGCGCGCGTGCGCACGCTGCTGCGCCGCGGCCAGGCGGTGCCGCAGGTTGAACGCATCGTCATTGCCGACCTGG
TGGTGGATACCCAGCGCCGCCGGGTGGAGCGTGGCGGCCAGCGCATCGCGCTCAGCCAGAAGGAGTACACCCTGCTGGAG
CTGCTGGCACGCCGCCGTGGCGAAGTGCTGCCGCGCTCGCTGATCGCCTCGCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAATGTCATCGATGTGGCGATCCGCCGCCTGCGCGCCAAGATCGACGATGATTTCGCCGACAAGCTGATCATTACCG
TGCGCGGCATGGGCTATGTACTGGAGGCGCCGGACGACGGCGCCGCGCGCAACGGATGA

Protein sequence :
MKLLIVEDEPKTGNYLRQGLIEAGYVVDLASNGIDGLHLAESGEYQLVILDVMLPGLDGWTVLSRLRGAGWPLPVLFLTA
RSSIADRVQGLELGADDYLAKPFAFAELLARVRTLLRRGQAVPQVERIVIADLVVDTQRRRVERGGQRIALSQKEYTLLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFADKLIITVRGMGYVLEAPDDGAARNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-61 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-60 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-71 68
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 7e-66 68
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 4e-72 67
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 1e-66 65
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 1e-66 64
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 2e-66 63
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 2e-64 61
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-36 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-34 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-34 41
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-34 41
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 4e-61 60
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 3e-43 45
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 2e-34 43
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 2e-36 42
Smal_2165 YP_002028552.1 two component heavy metal response transcriptional regulator, winged helix family VFG0473 Protein 3e-33 41