Gene Information

Name : Smal_2399 (Smal_2399)
Accession : YP_002028785.1
Strain : Stenotrophomonas maltophilia R551-3
Genome accession: NC_011071
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2700140 - 2700538 bp
Length : 399 bp
Strand : +
Note : PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: met:M446_0747 transcriptional regulator, MerR family

DNA sequence :
ATGAACATTGGACAACTGGCCCGCCAGGCTGGCGTGCCCATCGATACGGTCCGCTACTACGAGCGCCAGCAGCTGCTGCC
CACCGCCGCACGTTCGGCCGGTGGCTACCGCATCTTCGGTGAGCAGGACCTGCGCCGGCTGCGCTTCATCCGCCGGGCCA
AATCACTGGGCTTCAGCCTGGAAGAAATCGGCGAGCTGCTCGCGCTCAGTGATCGCCACCAGCAGGACATGGGCAGCGTC
CGCGACACGGCCCAGGCACGCCTGCTGGATATCGCGCAGCGGATGGCCGAACTGCAGCGCATGCACAACGCGCTGTCACA
ACTGGTCGATGCCTGCCCGGGGCACGGCACGCTGGATCAATGCCCGATCCTGGCCGCGCTGACCGACGACACTGCATGA

Protein sequence :
MNIGQLARQAGVPIDTVRYYERQQLLPTAARSAGGYRIFGEQDLRRLRFIRRAKSLGFSLEEIGELLALSDRHQQDMGSV
RDTAQARLLDIAQRMAELQRMHNALSQLVDACPGHGTLDQCPILAALTDDTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 5e-24 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-24 42
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0462 Protein 1e-25 45
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0688 Protein 4e-24 43
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0689 Protein 5e-23 42
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0569 Protein 3e-24 41
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0683 Protein 5e-24 41
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0684 Protein 5e-24 41
Smal_2399 YP_002028785.1 MerR family transcriptional regulator BAC0301 Protein 5e-20 41