Gene Information

Name : Smal_0470 (Smal_0470)
Accession : YP_002026858.1
Strain : Stenotrophomonas maltophilia R551-3
Genome accession: NC_011071
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 549850 - 550569 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bpt:Bpet2466 two-component response regulator

DNA sequence :
ATGTCGACCAAACGCGTGCTGATCGTCGAAGACGATGCCCACATCGCTGACCTGCTGCGCATGCACCTGGGCGATGAAGG
CTATGACGTGGCCCACGCCGCCAGCGGTGACGGTGGCCTGCGCCTGCTGGAACAGGACGGCCCATGGGATGCGCTGGTGC
TGGACGTGATGCTGCCCGGTGTCGACGGCCTGCAGGTGTGCCAGCGTGCACGCGCGATGGCGCGCTACGTGCCGATCATC
ATCATCAGCGCGCGCGGCAGCGAGACCCAGCGCATTGTCGGCCTGGAGCTGGGCGCGGACGACTACCTGGCAAAACCCTT
CTCGATGCCGGAACTGGTGGCACGGGTGCGCGCCCTGCTGCGCCGGGCCGAGGCGATGGCACAGAGCGCACGCATCGATG
CCGGCGCGATCGAGCTGGGCGGGCTGCAGCTGGATCCGGTCGCGCGCACCGCTTCGGTGGATGGCAATGCGCTGGAACTG
ACCCCGCGCGAGTTCGACCTGCTGCTGTTCTTCGCCCGCCACCCGGACCAGGTGTTCGCACGCATGGAACTGCTCAACCA
GGTCTGGGGTTACCAGCACGATGGTTACGAGCATACGGTCAATACCCACATCAACCGCCTGCGCAGCAAGATCGAGCCGG
ACCCGGCAAACCCGCGGCGGCTGCTGACGGTGTGGGGCCGCGGCTACAAGCTGGTCGACCCGGCCGGGGCGGCGGCATGA

Protein sequence :
MSTKRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDGGLRLLEQDGPWDALVLDVMLPGVDGLQVCQRARAMARYVPII
IISARGSETQRIVGLELGADDYLAKPFSMPELVARVRALLRRAEAMAQSARIDAGAIELGGLQLDPVARTASVDGNALEL
TPREFDLLLFFARHPDQVFARMELLNQVWGYQHDGYEHTVNTHINRLRSKIEPDPANPRRLLTVWGRGYKLVDPAGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-62 58
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-62 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-37 45
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-36 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-37 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-38 42
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-38 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-62 58
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-63 58
Smal_0470 YP_002026858.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-28 45