Gene Information

Name : SNSL254_A3082 (SNSL254_A3082)
Accession : YP_002042120.1
Strain : Salmonella enterica SL254
Genome accession: NC_011080
Putative virulence/resistance : Virulence
Product : cell invasion protein
Function : -
COG functional category : M : Cell wall/membrane/envelope biogenesis
COG ID : COG0741
EC number : -
Position : 2998039 - 2998521 bp
Length : 483 bp
Strand : +
Note : identified by match to protein family HMM PF01464

DNA sequence :
ATGCATTATTTTTTTATCATCGTAATCTGGTTGCTTAGCATAAATACGGCATGGGCTGATTGCTGGCTTCAGGCTGAAAA
AATGTTCAATATTGAATCCGAACTACTTTACGCTATCGCCCAGCAGGAATCGGCGATGAAACCTGGCGCCATTGGTCATA
ACCGAGATGGTTCAACCGATCTTGGCCTGATGCAAATTAACAGCTTCCATATGAAAAGGCTGAAAAAAATGGGGATTAGT
GAAAAACAGTTGTTACAGGACCCCTGCATTTCTGTCATTGTGGGCGCTTCCATTTTATCAGATATGATGAAAATCTACGG
TTATAGCTGGGAGGCCGTTGGCGCTTATAATGCCGGGACGTCGCCGAAACGATCGGATATAAGGAAACGTTATGCTAAAA
AAATTTGGGAGAATTACAGAAAATTAAAAGGAATGTCAGCAGAAGAGAAAAACAAAAGACTTTCTATCGCGTCAAACAAA
TAA

Protein sequence :
MHYFFIIVIWLLSINTAWADCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGIS
EKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIASNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
iagB YP_217796.1 cell invasion protein Virulence SPI-1 Protein 7e-71 100
iagB NP_457271.1 cell invasion protein Virulence SPI-1 Protein 8e-70 99
iagB NP_806480.1 cell invasion protein Virulence SPI-1 Protein 8e-70 99
iagB NP_461798.1 invasion protein precursor Virulence SPI-1 Protein 8e-71 99
unnamed AAC31524.1 L0045 Not tested LEE Protein 1e-18 45
ECs4579 NP_312606.1 hypothetical protein Not tested LEE Protein 2e-18 45
unnamed ACU09469.1 putative lytic transglycosylase Not tested LEE Protein 1e-18 45
ECO103_3629 YP_003223486.1 hypothetical protein Not tested LEE Protein 1e-18 45
ECO26_5260 YP_003232142.1 hypothetical protein Not tested LEE Protein 1e-18 45
unnamed AAK26704.1 unknown Not tested LEE Protein 1e-18 45
Z5131 NP_290279.1 hypothetical protein Not tested LEE Protein 2e-18 45
unnamed AAL57531.1 unknown Not tested LEE Protein 1e-18 45
st13 CAC81851.1 ST13 protein Not tested LEE II Protein 1e-18 45
unnamed CAI43885.1 hypothetical protein Not tested LEE Protein 1e-18 45
ECO111_3763 YP_003236099.1 hypothetical protein Not tested LEE Protein 3e-18 44
unnamed AAC38373.1 rOrf3 Not tested LEE Protein 2e-18 44
unnamed AAL06358.1 unknown Not tested LEE Protein 3e-19 44
etgA AFO66404.1 putative lytic transglycosylase Not tested SESS LEE Protein 1e-22 41
etgA AFO66324.1 putative lytic transglycosylase Not tested SESS LEE Protein 1e-22 41
ECs3711 NP_311738.1 hypothetical protein Not tested LIM Protein 1e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SNSL254_A3082 YP_002042120.1 cell invasion protein VFG0539 Protein 2e-71 99
SNSL254_A3082 YP_002042120.1 cell invasion protein VFG0823 Protein 6e-19 45
SNSL254_A3082 YP_002042120.1 cell invasion protein VFG0994 Protein 2e-26 44
SNSL254_A3082 YP_002042120.1 cell invasion protein VFG0719 Protein 9e-19 44
SNSL254_A3082 YP_002042120.1 cell invasion protein VFG1789 Protein 1e-15 41