Gene Information

Name : tetA (SeSA_B0032)
Accession : YP_002112912.1
Strain :
Genome accession: NC_011092
Putative virulence/resistance : Resistance
Product : tetracycline resistance protein, class A
Function : -
COG functional category : G : Carbohydrate transport and metabolism
COG ID : COG2814
EC number : -
Position : 30249 - 31448 bp
Length : 1200 bp
Strand : -
Note : identified by match to protein family HMM PF07690; match to protein family HMM TIGR00880

DNA sequence :
GTGAAACCCAACAGACCCCTGATCGTAATTCTGAGCACTGTCGCGCTCGACGCTGTCGGCATCGGCCTGATTATGCCGGT
GCTGCCGGGCCTCCTGCGCGATCTGGTTCACTCGAACGACGTCACCGCCCACTATGGCATTCTGCTGGCGCTGTATGCGT
TGATGCAATTTGCCTGCGCACCTGTGCTGGGCGCGCTGTCGGATCGTTTCGGGCGGCGGCCGGTCTTGCTCGTCTCGCTG
GCCGGCGCTGCTGTCGACTACGCCATCATGGCGACGGCGCCTTTCCTTTGGGTTCTCTATATCGGGCGGATCGTGGCCGG
CATCACCGGGGCGACTGGGGCGGTAGCCGGCGCTTATATTGCCGATATCACTGATGGCGATGAGCGCGCGCGGCACTTCG
GCTTCATGAGCGCCTGTTTCGGGTTCGGGATGGTCGCGGGACCTGTGCTCGGTGGGCTGATGGGCGGTTTCTCCCCCCAC
GCTCCGTTCTTCGCCGCGGCAGCCTTGAACGGCCTCAATTTCCTGACGGGCTGTTTCCTTTTGCCGGAGTCGCACAAAGG
CGAACGCCGGCCGTTACGCCGGGAGGCTCTCAACCCGCTCGCTTCGTTCCGGTGGGCCCGGGGCATGACCGTCGTCGCCG
CCCTGATGGCGGTCTTCTTCATCATGCAACTTGTCGGACAGGTGCCGGCCGCGCTTTGGGTCATTTTCGGCGAGGATCGC
TTTCACTGGGACGCGACCACGATCGGCATTTCGCTTGCCGCATTTGGCATTCTGCATTCACTCGCCCAGGCAATGATCAC
CGGCCCTGTAGCCGCCCGGCTCGGCGAAAGGCGGGCACTCATGCTCGGAATGATTGCCGACGGCACAGGCTACATCCTGC
TTGCCTTCGCGACACGGGGATGGATGGCGTTCCCGATCATGGTCCTGCTTGCTTCGGGTGGCATCGGAATGCCGGCGCTG
CAAGCAATGTTGTCCAGGCAGGTGGATGAGGAACGTCAGGGGCAGCTGCAAGGCTCACTGGCGGCGCTCACCAGCCTGAC
CTCGATCGTCGGACCCCTCCTCTTCACGGCGATCTATGCGGCTTCTATAACAACGTGGAACGGGTGGGCATGGATTGCAG
GCGCTGCCCTCTACTTGCTCTGCCTGCCGGCGCTGCGTCGCGGGCTTTGGAGCGGCGCAGGGCAACGAGCCGATCGCTGA

Protein sequence :
MKPNRPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHYGILLALYALMQFACAPVLGALSDRFGRRPVLLVSL
AGAAVDYAIMATAPFLWVLYIGRIVAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPH
APFFAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIMQLVGQVPAALWVIFGEDR
FHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALMLGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPAL
QAMLSRQVDEERQGQLQGSLAALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 2e-161 100
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 2e-161 100
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 2e-161 100
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 3e-161 100
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 1e-161 99
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 1e-161 99
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 8e-101 63
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 8e-101 63
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 8e-101 63
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 8e-101 63
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 2e-103 63
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 5e-74 49
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 1e-74 48
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 1e-74 48
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 1e-74 48
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 2e-74 48
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 2e-74 48
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 2e-74 48
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 2e-74 48
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 2e-74 48
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 3e-68 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_002112912.1 tetracycline resistance protein, class A NC_011586.7045189.p0 Protein 9e-151 100
tetA YP_002112912.1 tetracycline resistance protein, class A X75761.gene.p01 Protein 3e-160 99
tetA YP_002112912.1 tetracycline resistance protein, class A NC_010410.6002597.p0 Protein 6e-162 99
tetA YP_002112912.1 tetracycline resistance protein, class A CP001485.1.gene2821. Protein 6e-162 99
tetA YP_002112912.1 tetracycline resistance protein, class A AF534183.gene.p01 Protein 2e-158 99
tetA YP_002112912.1 tetracycline resistance protein, class A Y19114.gene.p01 Protein 3e-127 80
tetA YP_002112912.1 tetracycline resistance protein, class A AF133139.gene.p01 Protein 2e-105 63
tetA YP_002112912.1 tetracycline resistance protein, class A NC_010410.6002612.p0 Protein 1e-103 63
tetA YP_002112912.1 tetracycline resistance protein, class A AF133140.gene.p01 Protein 1e-103 63
tetA YP_002112912.1 tetracycline resistance protein, class A AF070999.gene.p01 Protein 4e-88 54
tetA YP_002112912.1 tetracycline resistance protein, class A AY264780.2.gene3.p01 Protein 5e-81 54
tetA YP_002112912.1 tetracycline resistance protein, class A Y19116.gene.p01 Protein 9e-78 53
tetA YP_002112912.1 tetracycline resistance protein, class A L06940.gene.p01 Protein 2e-79 53
tetA YP_002112912.1 tetracycline resistance protein, class A AY743590.gene.p01 Protein 1e-72 50
tetA YP_002112912.1 tetracycline resistance protein, class A L06798.gene.p01 Protein 1e-68 49
tetA YP_002112912.1 tetracycline resistance protein, class A AF121000.gene.p01 Protein 7e-70 48
tetA YP_002112912.1 tetracycline resistance protein, class A AJ420072.gene.p01 Protein 7e-68 48
tetA YP_002112912.1 tetracycline resistance protein, class A CP004022.1.gene2534. Protein 1e-69 48
tetA YP_002112912.1 tetracycline resistance protein, class A AF038993.gene.p01 Protein 3e-70 48
tetA YP_002112912.1 tetracycline resistance protein, class A NC_010558.1.6275971. Protein 6e-75 48
tetA YP_002112912.1 tetracycline resistance protein, class A AB084246.gene.p01 Protein 9e-75 48
tetA YP_002112912.1 tetracycline resistance protein, class A V00611.gene.p01 Protein 2e-74 48
tetA YP_002112912.1 tetracycline resistance protein, class A Y15510.gene.p01 Protein 4e-69 47
tetA YP_002112912.1 tetracycline resistance protein, class A AF090987.gene.p01 Protein 3e-64 47
tetA YP_002112912.1 tetracycline resistance protein, class A NC_011595.7059241.p0 Protein 1e-54 44
tetA YP_002112912.1 tetracycline resistance protein, class A NC_011586.7043399.p0 Protein 1e-54 44
tetA YP_002112912.1 tetracycline resistance protein, class A NC_010410.6003291.p0 Protein 1e-54 44
tetA YP_002112912.1 tetracycline resistance protein, class A AJ250203.gene.p01 Protein 2e-63 43
tetA YP_002112912.1 tetracycline resistance protein, class A NC_009085.4918440.p0 Protein 2e-48 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tetA YP_002112912.1 tetracycline resistance protein, class A VFG1036 Protein 6e-75 48