Gene Information

Name : MADE_1005525 (MADE_1005525)
Accession : YP_004426245.1
Strain : Alteromonas macleodii Deep ecotype
Genome accession: NC_011138
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1114325 - 1114777 bp
Length : 453 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGGTCACTTTAATTAGATATAAAGTAAGTAAACAAAAAGTCAGTAAGGTAATTGATAACGTGTCTAAACGAACCATAAG
TATGTTGGCTAAAGAACTGAGTGTAAATGTCGAAACAATTCGCTTTTATGAACGCAAAGGCTTAATTAAACAACCACCAA
AGCCTATGCAGGGCTATAGACATTACCCGAAAGAAACGGTAAATAGAATACATTTTATCAAGCGTTCTCAAGAATTAGGT
TTTACGCTAAATGAGATTGAAGGGTTACTTGCGTTAAACGATAGTCCATGTAGTAAAGTACAAGAATTAGCTAATAAAAA
ACTGATCGCAGTACAAAAAAAGATGGCTGACTTGTTGTTGTTAGAACACGCTTTGGAAGAACATTTAGGACAATGCCAAA
ATAATGATGACGATAGCCACTGCCCAATAATTGATTCGTTGCAACCGAAGTAA

Protein sequence :
MVTLIRYKVSKQKVSKVIDNVSKRTISMLAKELSVNVETIRFYERKGLIKQPPKPMQGYRHYPKETVNRIHFIKRSQELG
FTLNEIEGLLALNDSPCSKVQELANKKLIAVQKKMADLLLLEHALEEHLGQCQNNDDDSHCPIIDSLQPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-23 47
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-23 47
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-23 45
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-23 45
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-23 45
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-23 45
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-23 45
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-23 45
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-21 44
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-23 43
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-25 43
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 2e-17 42
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 1e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0688 Protein 2e-24 46
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0687 Protein 4e-23 46
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0232 Protein 4e-23 46
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0686 Protein 2e-23 46
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0682 Protein 3e-21 45
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0683 Protein 2e-23 45
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0684 Protein 6e-24 45
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0689 Protein 2e-22 43
MADE_1005525 YP_004426245.1 MerR family transcriptional regulator BAC0680 Protein 1e-17 41