Gene Information

Name : SeD_A1171 (SeD_A1171)
Accession : YP_002215027.1
Strain : Salmonella enterica CT_02021853
Genome accession: NC_011205
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1162134 - 1162814 bp
Length : 681 bp
Strand : -
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAAGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTCGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGAGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGAACCATTTGAAAAGAAGCTCATTATGACCGTCCGGGGGA
TGGGTTATCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAHQSPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDEPFEKKLIMTVRGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-103 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-102 99

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0197 Protein 3e-59 58
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0083 Protein 6e-56 57
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0125 Protein 1e-59 56
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0638 Protein 2e-52 56
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0308 Protein 4e-54 55
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0111 Protein 7e-57 53
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW BAC0347 Protein 3e-50 52
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 8e-34 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 1e-39 45
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 1e-39 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW VFG0596 Protein 1e-103 99
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW VFG0473 Protein 1e-29 42
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW VFG1389 Protein 4e-32 42
SeD_A1171 YP_002215027.1 transcriptional regulatory protein YedW VFG1390 Protein 8e-38 41