Gene Information

Name : copR (SG0985)
Accession : YP_002226050.1
Strain : Salmonella enterica 287/91
Genome accession: NC_011274
Putative virulence/resistance : Virulence
Product : transcriptional regulator YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1070774 - 1071520 bp
Length : 747 bp
Strand : -
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGACAATTATGTCATCTTGTTGGAGATTTACGGATTCGCTAACAAGCCTATGGCATACTGCGTTGATGAAGATTTTATT
GATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCGGGGACTCACGGAAGCAGGCTATGTGGTTGATTATGCCTGTG
ATGGACGAGACGGATTACACCTGGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGCTGCCGGGGCTTGAT
GGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGCGACTCGGTTGAGGA
TCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACTGCTGGCCCGGGTGA
GAGCTCAACTCAGACAGCATGTCCCTGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATGCCACAAAGCAATCG
GTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCGTCCCGGGCAGGAGA
AATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACACCGTTGATGTCGCGA
TTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCGGGGGATGGGTTATCGATTA
CAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MTIMSSCWRFTDSLTSLWHTALMKILLIEDNQKTIEWVRRGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLD
GWQVLRALRTAHQSPVICLTARDSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQS
VSRNGKPISLTRKEFLLLWLLASRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRL
QAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-102 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-112 98

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_002226050.1 transcriptional regulator YedW BAC0197 Protein 3e-59 59
copR YP_002226050.1 transcriptional regulator YedW BAC0083 Protein 9e-56 57
copR YP_002226050.1 transcriptional regulator YedW BAC0125 Protein 7e-60 56
copR YP_002226050.1 transcriptional regulator YedW BAC0638 Protein 4e-52 56
copR YP_002226050.1 transcriptional regulator YedW BAC0308 Protein 5e-54 55
copR YP_002226050.1 transcriptional regulator YedW BAC0111 Protein 2e-57 53
copR YP_002226050.1 transcriptional regulator YedW BAC0347 Protein 1e-50 51
copR YP_002226050.1 transcriptional regulator YedW NC_002758.1121390.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_010079.5776364.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_002952.2859858.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_007622.3794948.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW AE015929.1.gene1106. Protein 7e-34 45
copR YP_002226050.1 transcriptional regulator YedW NC_003923.1003417.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_013450.8614146.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_002951.3238224.p0 Protein 9e-40 45
copR YP_002226050.1 transcriptional regulator YedW NC_007793.3914065.p0 Protein 9e-40 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_002226050.1 transcriptional regulator YedW VFG0596 Protein 8e-103 99
copR YP_002226050.1 transcriptional regulator YedW VFG1389 Protein 1e-32 43
copR YP_002226050.1 transcriptional regulator YedW VFG0473 Protein 3e-29 41
copR YP_002226050.1 transcriptional regulator YedW VFG1390 Protein 3e-38 41