Gene Information

Name : terD (KPK_A0198)
Accession : YP_002235838.1
Strain :
Genome accession: NC_011282
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 147156 - 147734 bp
Length : 579 bp
Strand : -
Note : identified by similarity to SP:Q52357; match to protein family HMM PF02342

DNA sequence :
ATGAGCGTTTCACTATCTAAAGGCGGCAACGTTTCCCTGAGCAAAACCGCGCCAAGCATGAAAAACGTCCTGGTTGGCCT
TGGCTGGGATGCACGTTCTACGGACGGTCAGGACTTTGACCTCGATGCTTCCGCATTTCTGCTGGCAGCCAATGGCAAGG
TTCGTGGCGATGCAGATTTCATTTTCTATAACAACCTGAAATCTGCTGATGGTTCCGTTACTCATACCGGTGATAACCGT
ACCGGTGAAGGTGATGGCGACGATGAATCCCTCAAAATCAAACTGGACGCGGTACCTGGGGATGTCGACAAAATTATTTT
CGTTGTCACTATCCATGATGCTCAGGCTCGTCGCCAGAGCTTCGGTCAGGTTTCCGGCGCATTTATCCGTCTGGTGAATG
ATGACAATCAGACTGAAGTTGCTCGCTACGATCTGACAGAAGACGCTTCTACTGAAACTGCCATGCTGTTTGGGGAGCTG
TATCGTCACAACGGAGAATGGAAATTCCGTGCGGTTGGCCAGGGTTATGCTGGTGGACTGGCTTCCGTGTGCGCTCAGTA
CGGCATCAACGCGTCCTGA

Protein sequence :
MSVSLSKGGNVSLSKTAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLAANGKVRGDADFIFYNNLKSADGSVTHTGDNR
TGEGDGDDESLKIKLDAVPGDVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL
YRHNGEWKFRAVGQGYAGGLASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-75 97
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-75 97
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-75 96
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-60 71
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-54 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-54 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-54 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-53 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-20 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_002235838.1 tellurium resistance protein TerD BAC0389 Protein 9e-76 99
terD YP_002235838.1 tellurium resistance protein TerD BAC0390 Protein 6e-57 68