Gene Information

Name : KPK_4943 (KPK_4943)
Accession : YP_002240721.1
Strain : Klebsiella pneumoniae 342
Genome accession: NC_011283
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4984243 - 4984464 bp
Length : 222 bp
Strand : -
Note : identified by similarity to SP:Q9XB42

DNA sequence :
ATGAAAATCATCAGCAAACGCCAGGCAATGACCTTGTACCGGCAACATCCTGGCTCCCGACTGTTTCGCTTCAGTACGGG
CAAATATAAATGGTCAGGTAGTATCTGCCATTATGCTGGCCGCGAGGTGGAGGACATACGCGGCGTTCTGGCCGTGTTTG
CTGAACGTCGTCAGGACCGCAATGGTCCCTATGTCATTCTTCGAAGCGTTACTCTCAATTAA

Protein sequence :
MKIISKRQAMTLYRQHPGSRLFRFSTGKYKWSGSICHYAGREVEDIRGVLAVFAERRQDRNGPYVILRSVTLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 2e-16 71
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 6e-19 69
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 6e-19 69
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 5e-19 69
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 4e-19 69
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 4e-19 69
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 1e-18 68
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-18 68
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-18 68
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 1e-18 68
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 6e-19 68
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 2e-18 68
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-18 68
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 2e-18 66
unnamed AAL08476.1 unknown Not tested SRL Protein 2e-18 66
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 3e-18 66
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 1e-17 65
unnamed AAL57578.1 unknown Not tested LEE Protein 7e-16 64
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 7e-16 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KPK_4943 YP_002240721.1 hypothetical protein VFG1679 Protein 2e-19 69
KPK_4943 YP_002240721.1 hypothetical protein VFG0661 Protein 2e-19 69
KPK_4943 YP_002240721.1 hypothetical protein VFG1618 Protein 2e-19 69
KPK_4943 YP_002240721.1 hypothetical protein VFG1529 Protein 7e-19 68
KPK_4943 YP_002240721.1 hypothetical protein VFG1067 Protein 8e-19 66