Gene Information

Name : DICTH_1122 (DICTH_1122)
Accession : YP_002250961.1
Strain : Dictyoglomus thermophilum H-6-12
Genome accession: NC_011297
Putative virulence/resistance : Virulence
Product : response regulator DrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1089291 - 1089989 bp
Length : 699 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGAAAAAGATTCTTTTAGTAGAGGATGATAAGGGCATTGTTAATTCTCTATCTCTCCTGTTAAACAAAGAGGGATATGA
AGTAGAAGTTGCCTATGATGGAGTAGAAGCTTTAAACAAATTTAAATTGTTTAATCCAGATCTTGTACTACTGGATATTA
TGCTTCCAGAAAAAGACGGTTGGGAAGTATGTAAAGAAATAAGAAAAATAAGTAATGTTCCTATTATTATGCTCACTGCT
AAAGATGAGGAAGTGGATAAGGTATTAGGATTAAAAATGGGGGCAGATGACTATATTACTAAACCTTTTGGGGCTAAGGA
ACTTTTAGCAAGAATTGAAGCAGTACTTCGTAGATACCAATCAGATTTATCAAAAAGCCAGAAGATTGTAGCTCCTCCTT
TTGAGATGGATCTTGTTAAGAGAACAGTAAAAGTAAAGGGAAAAGAAGTTAATCTATCCTATAGAGAGTTTGAGATTTTA
AAACTTCTTCTTTCTTCTCCAGGAAGAGTGTGGACTAGAGATATGATAATAAAGCACATATGGGGCGAAAATTTCTGGGG
TGAGCCTAGAGCGGTGGATGTTTACATAAGATGGTTAAGAGAGAAGGTTGAAGATGATCCAAGTCATCCCAAATATATTA
TTACAGTTAGAAATTTAGGTTATAAATTCCAGGAGGGAAATGAAGATAAGCAAGATTGA

Protein sequence :
MKKILLVEDDKGIVNSLSLLLNKEGYEVEVAYDGVEALNKFKLFNPDLVLLDIMLPEKDGWEVCKEIRKISNVPIIMLTA
KDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVLRRYQSDLSKSQKIVAPPFEMDLVKRTVKVKGKEVNLSYREFEIL
KLLLSSPGRVWTRDMIIKHIWGENFWGEPRAVDVYIRWLREKVEDDPSHPKYIITVRNLGYKFQEGNEDKQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DICTH_1122 YP_002250961.1 response regulator DrrA NC_012469.1.7685629. Protein 2e-48 49
DICTH_1122 YP_002250961.1 response regulator DrrA NC_009641.5332272.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_013450.8614421.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_007793.3914279.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_007622.3794472.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002745.1124361.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_009782.5559369.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002951.3237708.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002952.2859905.p0 Protein 2e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_003923.1003749.p0 Protein 9e-43 45
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002758.1121668.p0 Protein 1e-42 45
DICTH_1122 YP_002250961.1 response regulator DrrA AE015929.1.gene1106. Protein 3e-29 44
DICTH_1122 YP_002250961.1 response regulator DrrA NC_012469.1.7686381. Protein 1e-36 44
DICTH_1122 YP_002250961.1 response regulator DrrA NC_010079.5776364.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002952.2859858.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_007622.3794948.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_003923.1003417.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_013450.8614146.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002951.3238224.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_007793.3914065.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA NC_002758.1121390.p0 Protein 1e-35 43
DICTH_1122 YP_002250961.1 response regulator DrrA AE000516.2.gene3505. Protein 3e-39 43
DICTH_1122 YP_002250961.1 response regulator DrrA HE999704.1.gene1528. Protein 5e-30 42
DICTH_1122 YP_002250961.1 response regulator DrrA FJ349556.1.orf0.gene Protein 7e-35 42
DICTH_1122 YP_002250961.1 response regulator DrrA HE999704.1.gene2815. Protein 1e-36 42
DICTH_1122 YP_002250961.1 response regulator DrrA AF155139.2.orf0.gene Protein 2e-35 42
DICTH_1122 YP_002250961.1 response regulator DrrA NC_005054.2598277.p0 Protein 4e-37 41
DICTH_1122 YP_002250961.1 response regulator DrrA NC_014475.1.orf0.gen Protein 4e-37 41
DICTH_1122 YP_002250961.1 response regulator DrrA BAC0125 Protein 1e-33 41
DICTH_1122 YP_002250961.1 response regulator DrrA CP000034.1.gene3671. Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DICTH_1122 YP_002250961.1 response regulator DrrA VFG0596 Protein 9e-34 41
DICTH_1122 YP_002250961.1 response regulator DrrA VFG1390 Protein 3e-37 41