Gene Information

Name : VSAL_II0561 (VSAL_II0561)
Accession : YP_002264887.1
Strain :
Genome accession: NC_011313
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 615528 - 615839 bp
Length : 312 bp
Strand : +
Note : -

DNA sequence :
ATGACAAAACGTCCAAGAAAGAACTATAGCGCGTCATACAAGTTAGAAGCAGCTCAGTTAGTCACCGAGCAAGGTTACTC
AATTACTGAAGCTTCTCAAGCTATGAACGTAAGTAAATCAGCGATGACTAATTGGGTTCAACAGCTAAAAAGTGAATTAA
GCGGAGTGATGCCAACGGCATCACTTATAACTCCCGAGCAAATAGAAATTCGTGAGTTAAAGAAAAAACTTGCTCGTCTT
GAGGAGCATAATGAAATACTAAAAAAGGCTACGGCTCTGTTGATGTCAGACTCACTGAACAATTCGCATTAA

Protein sequence :
MTKRPRKNYSASYKLEAAQLVTEQGYSITEASQAMNVSKSAMTNWVQQLKSELSGVMPTASLITPEQIEIRELKKKLARL
EEHNEILKKATALLMSDSLNNSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 76
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 76
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 76
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 76
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 76
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 76
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 76
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 76
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-25 64
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-25 62
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-25 62
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-21 60
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-20 56
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-24 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-24 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-24 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-24 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-24 53
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-25 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-19 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VSAL_II0561 YP_002264887.1 transposase VFG1123 Protein 9e-32 76
VSAL_II0561 YP_002264887.1 transposase VFG1485 Protein 1e-25 62
VSAL_II0561 YP_002264887.1 transposase VFG1553 Protein 2e-20 56
VSAL_II0561 YP_002264887.1 transposase VFG0784 Protein 2e-24 53