
|
Name : eprI (ECH74115_5047) Accession : YP_002273151.1 Strain : Escherichia coli EC4115 Genome accession: NC_011353 Putative virulence/resistance : Virulence Product : type III secretion apparatus needle protein Function : - COG functional category : - COG ID : - EC number : - Position : 4693476 - 4693697 bp Length : 222 bp Strand : - Note : identified by match to protein family HMM PF09392; match to protein family HMM TIGR02105 DNA sequence : ATGAATTTATCTGAAATTACTCAACAAATGGGTGAAGTAGGTAAAACGCTGAGCGATTCTGTGCCAGAGTTACTTAATAG CACCGATTTGGTTAATGACCCTGAAAAAATGTTAGAGTTGCAGTTTGCGGTTCAGCAATATTCTGCTTATGTTAACGTAG AAAGTGGAATGTTGAAAACGATAAAAGATCTGGTCTCAACCATTTCTAACCGTAGTTTTTAA Protein sequence : MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKTIKDLVSTISNRSF |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| escF | AAL60254.1 | EscF | Virulence | LEE | Protein | 5e-28 | 100 |
| escF | YP_003232169.1 | T3SS structure protein EscF | Virulence | LEE | Protein | 8e-28 | 100 |
| escF | CAC81878.1 | EscF protein | Virulence | LEE II | Protein | 5e-28 | 100 |
| escF | CAI43858.1 | EscF protein | Virulence | LEE | Protein | 5e-28 | 100 |
| eprI | ACU09442.1 | type III secretion apparatus needle protein EprI | Virulence | LEE | Protein | 5e-28 | 100 |
| escF | YP_003223459.1 | T3SS structure protein EscF | Virulence | LEE | Protein | 8e-28 | 100 |
| escF | AAC38398.1 | EscF | Virulence | LEE | Protein | 5e-28 | 100 |
| escF | AAC31497.1 | L0018 | Virulence | LEE | Protein | 5e-28 | 100 |
| escF | YP_003236072.1 | T3SS structure protein EscF | Virulence | LEE | Protein | 8e-28 | 100 |
| escF | AAK26731.1 | EscF | Virulence | LEE | Protein | 5e-28 | 100 |
| escF | NP_290252.1 | hypothetical protein | Virulence | LEE | Protein | 8e-28 | 100 |
| escF | AAL57558.1 | EscF | Virulence | LEE | Protein | 5e-28 | 100 |
| ECs4552 | NP_312579.1 | protein EscF | Virulence | LEE | Protein | 8e-28 | 100 |
| escF | AFO66347.1 | putative LEE-encoded type III secretion system structural component | Not tested | SESS LEE | Protein | 2e-26 | 88 |
| escF | AFO66385.1 | putative LEE-encoded type III secretion system structural component | Virulence | SESS LEE | Protein | 2e-26 | 88 |
| unnamed | AAL06385.1 | EscF | Virulence | LEE | Protein | 3e-21 | 60 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| eprI | YP_002273151.1 | type III secretion apparatus needle protein | VFG0796 | Protein | 2e-28 | 100 |
| eprI | YP_002273151.1 | type III secretion apparatus needle protein | VFG0746 | Protein | 2e-28 | 100 |