Gene Information

Name : swp_0243 (swp_0243)
Accession : YP_002309671.1
Strain : Shewanella piezotolerans WP3
Genome accession: NC_011566
Putative virulence/resistance : Virulence
Product : Response regulator receiver:Transcriptional regulatory protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 258014 - 258697 bp
Length : 684 bp
Strand : -
Note : Response regulator receiver:Transcriptional regulatory protein, C-terminal

DNA sequence :
ATGAGCCGTATATTGTTGATAGATGATGATTTAGGTCTTTCAGAATTGCTAGCGCAGCTATTAGAGCTTGAAGGATTTGA
ACTAACGTTAGCCCATGATGGACAGGTAGGGCTCGATCTTGCCGTTGAGCAATCGTTTGACCTTATCTTGTTAGATGTGA
TGCTACCAAAGCTAAATGGTTTTGAAGTATTACGTGCACTACGCACTAAAAAACAAACCCCAGTGCTGATGTTAACCGCC
CGCGGTGATGAAATAGATAGGGTGGTTGGCCTTGAAATTGGTGCAGATGATTATTTGCCAAAACCGTTCAACGACCGTGA
ACTTGTTGCTCGCATTCGTGCGATTATTCGCCGCACAAATGTGCACACAGATGACAAAACTCAAGCGGTACAGACTTTTG
GCGATCTCAAATTAGATCCTGCCCGCCAAGAAGTTCACTGCCAAGATCAACTTATTGTGCTTACAGGAACCGAATTTAGC
TTGCTCTTCGAACTGGTACATCATGCTGGAGAGCTTGCATCCAAAGAGGTACTCAGCGAAAAAGTGTTAGGTAAAAAGCT
GATGCCATTTGATCGCAGTTTAGACATGCACCTTTCTAACTTGCGTAAAAAAATGCCCGAACGCATCGATGGACGCCCAA
GGGTGAAGACTATCCGCGGTAAAGGCTACATCTGGTTACCCTAA

Protein sequence :
MSRILLIDDDLGLSELLAQLLELEGFELTLAHDGQVGLDLAVEQSFDLILLDVMLPKLNGFEVLRALRTKKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELVARIRAIIRRTNVHTDDKTQAVQTFGDLKLDPARQEVHCQDQLIVLTGTEFS
LLFELVHHAGELASKEVLSEKVLGKKLMPFDRSLDMHLSNLRKKMPERIDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP001485.1.gene721.p Protein 2e-54 60
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP001138.1.gene4273. Protein 9e-49 59
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP004022.1.gene3215. Protein 2e-53 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP001918.1.gene5135. Protein 3e-48 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP000647.1.gene4257. Protein 2e-48 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein NC_002695.1.915041.p Protein 2e-48 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein BAC0533 Protein 2e-48 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP000034.1.gene3834. Protein 2e-48 58
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP000675.2.gene1535. Protein 1e-42 54
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein HE999704.1.gene2815. Protein 4e-32 43
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein CP000034.1.gene3671. Protein 5e-31 43
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein NC_012469.1.7686381. Protein 9e-34 41
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein NC_008702.1.4607594. Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein VFG1390 Protein 8e-29 42
swp_0243 YP_002309671.1 Response regulator receiver:Transcriptional regulatory protein VFG0596 Protein 9e-29 41