Gene Information

Name : E2348C_2974 (E2348C_2974)
Accession : YP_002330458.1
Strain : Escherichia coli E2348/69
Genome accession: NC_011601
Putative virulence/resistance : Unknown
Product : transposase Orf1 of IS3 family IS element
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 3066375 - 3066686 bp
Length : 312 bp
Strand : -
Note : -

DNA sequence :
ATGAACAAGAAAACCAAACGTACTTTCACCCCCGAGTTCAGACTGGAATGTGCGCAACTGATTGTTGATAAGGGCTACTC
ATATCGACAAGCCAGTGAATCGATGAATGTCGGCTCTACCACTCTTGAGAGCTGGGTACGTCAGCTCAGACGAGAGCGCC
AGGGGATTGCCCCCTCTGCCACACCGATTACTCCAGACCAGCAACGTATCCGCGAGCTGGAAAAGCAGGTTCGCCGCCTG
GAGGAACAAAATACGATATTAAAAAAGGCTACTGCACTCTTGATGTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MNKKTKRTFTPEFRLECAQLIVDKGYSYRQASESMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQRIRELEKQVRRL
EEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-43 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-43 99
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-42 98
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-42 98
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-42 98
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-42 98
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-28 62
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-28 62
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-28 62
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-28 62
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-28 62
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-28 62
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 3e-28 62
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-28 62
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-24 60
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-24 59
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-24 59
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 54
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-22 52
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 7e-22 51
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 51
tnpA CAB61575.1 transposase A Not tested HPI Protein 8e-20 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
E2348C_2974 YP_002330458.1 transposase Orf1 of IS3 family IS element VFG0784 Protein 9e-43 98
E2348C_2974 YP_002330458.1 transposase Orf1 of IS3 family IS element VFG1123 Protein 1e-28 62
E2348C_2974 YP_002330458.1 transposase Orf1 of IS3 family IS element VFG1485 Protein 1e-24 59
E2348C_2974 YP_002330458.1 transposase Orf1 of IS3 family IS element VFG1553 Protein 5e-23 52