Gene Information

Name : Tmz1t_4055 (Tmz1t_4055)
Accession : YP_002891010.1
Strain : Thauera sp. MZ1T
Genome accession: NC_011662
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4454907 - 4455587 bp
Length : 681 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGAAGATCCTGATCGTCGAAGACGAAGTGAAGACCGGCGACTACCTGCGCCAGGGCCTGACCGAGGCCGGATTCGTCGT
CGATCTCGCGCGCGACGGCCTCGATGGACTTCACCTCGCGCTCAGCGGCGACTACGACCTCATCGTGCTGGACGTGATGC
TGCCGTCGCTGGACGGCTGGGCCATCCTGCAGACACTGCGTCGCAGCGGTCGCGAGAACCCGGTGTTGTTCCTGACCGCC
CGTGACCAGATCGAGGACCGCGTTCGTGGCCTCGAGCTTGGCGCCGATGATTACCTGGTCAAGCCCTTCGCATTCTCCGA
GTTCCTCGCCCGGGTCCGCACCCTGCTGCGCAGGGGGCGGAGCCATGAACCGGACACCCTGCGCTCGGCGAATCTCGAAC
TGGATCTGCTTCGCCGCCGCGTGACGCGCTGCGGGCAGCGCATCGACCTGACCGCCAAGGAATTCGCCCTGCTCGAACTG
CTGCTGCGGCGCAAGGGTGAAGTGTTGCCGCGCTCCTTGATCGCCTCCCAGGTGTGGGACATGAACTTCGACAGCGACAC
CAATGTGATCGAGGTCGCTGTACGCAGGCTGAGGGTGAAGGTCGACGACCCCTTCGAGCCCAAGCTGATCCGCACCGTGC
GCGGCATGGGCTACGTGCTCGAAGCGATGGAGCCGAGCTGA

Protein sequence :
MKILIVEDEVKTGDYLRQGLTEAGFVVDLARDGLDGLHLALSGDYDLIVLDVMLPSLDGWAILQTLRRSGRENPVLFLTA
RDQIEDRVRGLELGADDYLVKPFAFSEFLARVRTLLRRGRSHEPDTLRSANLELDLLRRRVTRCGQRIDLTAKEFALLEL
LLRRKGEVLPRSLIASQVWDMNFDSDTNVIEVAVRRLRVKVDDPFEPKLIRTVRGMGYVLEAMEPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-60 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-60 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 8e-67 71
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 9e-73 68
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 8e-71 67
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 2e-70 67
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 2e-72 67
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 4e-70 63
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 3e-66 61
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-36 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 3e-29 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 5e-29 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 7e-32 41
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 6e-61 61
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 4e-43 47
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 2e-34 44
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 6e-31 42
Tmz1t_4055 YP_002891010.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 5e-35 42