Gene Information

Name : Msil_0834 (Msil_0834)
Accession : YP_002361166.1
Strain : Methylocella silvestris BL2
Genome accession: NC_011666
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator PhoB
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 919206 - 920003 bp
Length : 798 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bid:Bind_3413 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAGCGATATTCACGCCAACGCCGACAGCAAAACCGACGGCCGGCCGGGCGCCGCCCGCGGCCTTTCGCCAACGCCGGC
GCCGCGCATCCTTATCGTCGAGGACGAAGCGGCGCTGAGCATGCTGCTCGCCTATAATCTTGAAGCCGAGGGCTTTGTCG
TCGATCGCGTCGAGCGCGGCGACGAAGCGGAAATCAGGCTCAGCGAGACCATGCCCGATCTCGTCATTCTCGACTGGATG
CTGCCCGGCGTGTCGGGCCTTGAGATCTGCCGCCGCATGCGGGCGCGCGAGGCCACGCGCAGCCTGCCGGTCATCATGCT
CACCGCGCGTGGCGAGGAGAGCGAGCGCGTGCGCGGCCTCTCCATCGGCGCCGATGACTATGTGGTGAAGCCCTTTTCCG
TGCCGGAGCTGATGGCGCGAGTGCGCTCACTGTTGCGCCGCGCGCGGCCGGACCGCGTCGCCGCCGTGCTTTCGGCGGGA
GACCTCGAACTCGACCGGCAGAACTGGCGCGTTCGGCGCACCGGCCGCGACGTGCATCTCGGCCCGACCGAATTCCGTCT
GCTGGAGCATCTGATGGAGCGCCCCGGCCGCGTTTTCTCTCGCGCGCAACTGCTGGACAGCGTCTGGGGACTTTCGGCGG
AAATCGACGAGCGGACGGTCGACGTCCATGTCGGCCGGCTGCGCAAGGCGCTGACGGCGCCAGGCGAACGCGATCCGATC
CGCACGGTGCGCGGCGCGGGCTATTCCTTCGATGAAACTTTTGGGAAAGGGCCGGGGGCTTCAGACCGGACGCCTTGA

Protein sequence :
MSDIHANADSKTDGRPGAARGLSPTPAPRILIVEDEAALSMLLAYNLEAEGFVVDRVERGDEAEIRLSETMPDLVILDWM
LPGVSGLEICRRMRAREATRSLPVIMLTARGEESERVRGLSIGADDYVVKPFSVPELMARVRSLLRRARPDRVAAVLSAG
DLELDRQNWRVRRTGRDVHLGPTEFRLLEHLMERPGRVFSRAQLLDSVWGLSAEIDERTVDVHVGRLRKALTAPGERDPI
RTVRGAGYSFDETFGKGPGASDRTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-37 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0197 Protein 2e-33 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_010410.6002989.p0 Protein 3e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_010400.5986590.p0 Protein 2e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_002516.2.879194.p Protein 3e-33 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_011595.7057856.p0 Protein 3e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB CP001918.1.gene3444. Protein 6e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB CP000647.1.gene2531. Protein 6e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_012469.1.7685629. Protein 1e-36 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB AE000516.2.gene3505. Protein 1e-35 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0596 Protein 5e-37 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB CP000034.1.gene2186. Protein 6e-37 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB CP001138.1.gene2239. Protein 5e-37 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB NC_002695.1.916589.p Protein 4e-37 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0039 Protein 6e-37 42
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0347 Protein 2e-31 41
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0308 Protein 1e-32 41
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0125 Protein 4e-33 41
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB BAC0083 Protein 7e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB VFG1702 Protein 3e-37 44
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB VFG1390 Protein 6e-38 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB VFG1563 Protein 3e-36 43
Msil_0834 YP_002361166.1 winged helix family two component transcriptional regulator PhoB VFG1389 Protein 4e-30 42