Gene Information

Name : PCC8801_3460 (PCC8801_3460)
Accession : YP_002373583.1
Strain : Cyanothece sp. PCC 8801
Genome accession: NC_011726
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3613997 - 3614749 bp
Length : 753 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mar:MAE_52640 OmpR family two-component response regulator

DNA sequence :
ATGCTATCTCTGGACTTAGCTGAGTCTTCATCCTTAGAGAAAATCGTCCCTAACCATCGAATTTTAGTCGTTGAAGACGA
GGATGTGATTCGGGATATGATCACCATCGCCTTAGAAGAACAAGGCTACGAAGTGATAACAGCAAGCGATGGACGAACCG
CTTTAAGCTTATTACAAGATGTTGCCACCCTAGGAACTGAGTCAGGTTTTGACCTAGTGGTACTGGATTTGATGTTACCT
CAGGTTAACGGCTTAGATATCTGCCGTCTGCTACGTTATAATAACAATATTGTACCTATTCTGATACTCAGTGCCAAAGC
CAGCGAAACCGACCGGGTACTAGGATTAGAAGTAGGAGCCGATGATTATCTAACGAAACCCTTTAGTATGCGCGAGTTAG
TCGCGCGGTGTCGTGCTTTAATTCGTCGTCAAGACTTTAACAACGTTTCCTCCGCCCCAGTTCGTAAGTTCAAAGATATT
AGCCTTTATCCCGAAGAATGTCGGGTAGTTGTTCGTGGAGAAGAAATTAACCTTTCTCCTAAAGAATATCGTCTATTAGA
GCTATTTATGAGTTATCCTCGTCGGGTTTGGTCCCGTGAACAGTTGATTGATCAAGTGTGGGGGGCTGATTTCCTAGGAG
ATACCAAAACCGTTGATGTTCATATTCGTTGGTTACGCGAAAAATTAGAAACCGATCCCAGTCAACCAGAATATCTCATT
ACAGTACGAGGATTTGGCTATCGCTTCGGGTAA

Protein sequence :
MLSLDLAESSSLEKIVPNHRILVVEDEDVIRDMITIALEEQGYEVITASDGRTALSLLQDVATLGTESGFDLVVLDLMLP
QVNGLDICRLLRYNNNIVPILILSAKASETDRVLGLEVGADDYLTKPFSMRELVARCRALIRRQDFNNVSSAPVRKFKDI
SLYPEECRVVVRGEEINLSPKEYRLLELFMSYPRRVWSREQLIDQVWGADFLGDTKTVDVHIRWLREKLETDPSQPEYLI
TVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 45
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-47 44
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-45 44
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-42 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 42
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-37 41
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-28 43
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 42
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-36 42
PCC8801_3460 YP_002373583.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-38 41