Gene Information

Name : EFER_2794 (EFER_2794)
Accession : YP_002383899.1
Strain : Escherichia fergusonii ATCC 35469
Genome accession: NC_011740
Putative virulence/resistance : Virulence
Product : regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2862316 - 2862525 bp
Length : 210 bp
Strand : +
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type h : extrachromosomal origin

DNA sequence :
ATGATGAGCAACGATAGCATTATTAATACGACACTTATTGATATGAAATTTATCTGCGAACGTCTCGGTATGACGGATAA
GTGGATTTATAAACTTATTCAGGATGGACGCTTCCCAAAACCAATTAAACTGGGACGCTCCTCCAAGTGGAAACTTAGCG
AAGTTGACCAGTGGTTGCAGGACCAGATAATTGCCTCACGCGGCAGCTGA

Protein sequence :
MMSNDSIINTTLIDMKFICERLGMTDKWIYKLIQDGRFPKPIKLGRSSKWKLSEVDQWLQDQIIASRGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 7e-13 66
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 7e-13 66
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 1e-15 63
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-15 63
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-14 56
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 5e-14 56
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 6e-14 53
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 9e-14 53
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 9e-14 53
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 7e-14 53
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 7e-14 53
unnamed AAL08466.1 unknown Not tested SRL Protein 8e-14 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EFER_2794 YP_002383899.1 regulatory protein VFG1480 Protein 5e-16 63
EFER_2794 YP_002383899.1 regulatory protein VFG0651 Protein 3e-14 53
EFER_2794 YP_002383899.1 regulatory protein VFG1057 Protein 3e-14 52