Gene Information

Name : yeeV (ECS88_3315)
Accession : YP_002392924.1
Strain : Escherichia coli S88
Genome accession: NC_011742
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3271788 - 3272279 bp
Length : 492 bp
Strand : +
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 14594833; Product type f : factor

DNA sequence :
TTGGCAGTTGTGGTTACGTTTATCTGGCTGTTTATCCGACACCGGCAGCGCCCGCAATCACCGTATAACCCCGGATATCT
CCCCTTTATCACCACCTGTTACAGAGAACTTAAGATGAATACATTACCCGACACTCACGTACGGGAGGCATCGGGCTGCC
CGTCTCCCGTCACCATCTGGCAGACACTGCTCACCCGACTGCTGGACCAGCACTATGGCCTCACGCTGAATGACACACCG
TTCGCTGATGAACGTGTGATTGAGCAGCATATTGAGGCAGGGATTTCACTGTGTGACGCGGTGAACTTTCTCGTTGAAAA
ATACGCGCTGGTACGTACCGACCAGCCGGGATTCAGCGCAGGAGCCCCGTCGCAGTTAATCAACAGCATTGATATTCTCC
GGGCTCGCAGGGCAACCGGCCTGATGACCCGGAACAATTACAGAATGGTAAATAACATTACCCAGGGCAAGCATCCGGAG
GCAAAACAATGA

Protein sequence :
MAVVVTFIWLFIRHRQRPQSPYNPGYLPFITTCYRELKMNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTP
FADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGFSAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPE
AKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-54 100
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-73 99
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 2e-53 97
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 4e-53 97
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 4e-53 97
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-51 96
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 7e-51 93
unnamed AAC31486.1 L0007 Not tested LEE Protein 8e-49 92
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 8e-49 92
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 8e-49 92
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-48 92
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 5e-49 92
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-48 92
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-48 92
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 3e-47 91
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-49 91
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-49 91
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 9e-49 90
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 9e-49 90
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 9e-49 90
unnamed AAL08478.1 unknown Not tested SRL Protein 6e-47 89
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 2e-47 89

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0663 Protein 1e-53 97
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1682 Protein 3e-49 92
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG0786 Protein 3e-49 92
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1620 Protein 2e-49 92
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1530 Protein 1e-47 91
yeeV YP_002392924.1 toxin of the YeeV-YeeU toxin-antitoxin system VFG1069 Protein 2e-47 89