Gene Information

Name : yeeW (ECED1_3494)
Accession : YP_002399359.1
Strain : Escherichia coli ED1a
Genome accession: NC_011745
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3425435 - 3425923 bp
Length : 489 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGAAACGTTCCCTGATGCTGGAAGCCGACAGAATTAATGTGCAGGCACTGAACATGGGGCGAATTGTCGTTGACGTCGA
TGGTGTTAATCTCACTGAACTGATTAACAAGGTCGCTGAAAACGGTTATTCACTCCGCGTGGTGGAGGAATCCGACCAAC
AGTCAACCTGCACACTACCACCGTTTGCAACCCTTGCCGGCATACGCTGCAGTACCGCACATATCACGGAAAAGGATAAC
GCCTGGCTGTACTCGCTGTCACACCAGACCAGTGACTTCGGTGAATCAGAATGGATTCATTTCACAGGTAGCGGATATCT
GTTACGTACCGATGCGTGGTCATATCCGGTTCTGCGGCTTAAACGCCTGGGGCTGTCAAAAACGTTCCGTCGTCTGGTTA
TCACACTTACCCGACGTTATGGCGTCAGTCTCATTCATCTGGATGCCAGCGCTGAATGCCTGCCGGGTTTACCCACTTTC
AACTGGTAA

Protein sequence :
MKRSLMLEADRINVQALNMGRIVVDVDGVNLTELINKVAENGYSLRVVEESDQQSTCTLPPFATLAGIRCSTAHITEKDN
AWLYSLSHQTSDFGESEWIHFTGSGYLLRTDAWSYPVLRLKRLGLSKTFRRLVITLTRRYGVSLIHLDASAECLPGLPTF
NW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 6e-71 99
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 1e-68 97
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 1e-66 92
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-67 92
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 8e-67 91
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 2e-63 87
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 2e-63 87
unnamed AAL08479.1 unknown Not tested SRL Protein 2e-62 86
unnamed AAC31487.1 L0008 Not tested LEE Protein 1e-62 86
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 1e-62 86
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 1e-62 86
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 1e-62 86
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-61 86
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 3e-64 86
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-61 86
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 1e-61 86
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 8e-57 86
unnamed AAL67388.1 L0008-like protein Not tested PAI II CFT073 Protein 3e-56 86
unnamed AAL57574.1 unknown Not tested LEE Protein 5e-54 85
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 4e-62 84
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 4e-62 84
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 4e-59 84
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 3e-59 83
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 1e-59 83

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeW YP_002399359.1 hypothetical protein VFG1070 Protein 7e-63 86
yeeW YP_002399359.1 hypothetical protein VFG0787 Protein 4e-63 86
yeeW YP_002399359.1 hypothetical protein VFG1621 Protein 5e-62 86
yeeW YP_002399359.1 hypothetical protein VFG0664 Protein 1e-62 84
yeeW YP_002399359.1 hypothetical protein VFG1531 Protein 2e-59 84
yeeW YP_002399359.1 hypothetical protein VFG1683 Protein 5e-60 83