Gene Information

Name : EC55989_2917 (EC55989_2917)
Accession : YP_002403919.1
Strain : Escherichia coli 55989
Genome accession: NC_011748
Putative virulence/resistance : Unknown
Product : transposase ORF A, IS3 family
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2991689 - 2992036 bp
Length : 348 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; Product type pe : enzyme

DNA sequence :
GTGATATTCTCACCACAACACAAAACAGGTGACTTAATGAACAAGAAAACCAAACGAACCTTCACCCCTGAGTTCAGGCT
GGAATGTGCACAGCTGATTGTTGATAAGGGCTACTCATATCGACAGGCCAGTGAAGCGATGAATGTCGGTTCAACCACGC
TTGAGAGCTGGGTACGCCAGCTCAGGCGAGAGCGCCAGGGTATTACGCCCTCTGCCACACCCATTACTCCAGACCAGCAA
CGTATCCGCGAGCTGGAAAAGCAAGTTCGCCGTCTGGAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTAAT
GTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MIFSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQ
RIRELEKQVRRLEEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-50 100
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-50 100
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 4e-42 98
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-47 97
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-47 97
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-47 97
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 64
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 64
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 64
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-24 62
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-24 61
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-24 61
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-19 56
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-23 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 52
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-22 51
tnpA CAB61575.1 transposase A Not tested HPI Protein 7e-20 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EC55989_2917 YP_002403919.1 transposase ORF A, IS3 family VFG0784 Protein 5e-48 97
EC55989_2917 YP_002403919.1 transposase ORF A, IS3 family VFG1123 Protein 6e-32 64
EC55989_2917 YP_002403919.1 transposase ORF A, IS3 family VFG1485 Protein 5e-25 61
EC55989_2917 YP_002403919.1 transposase ORF A, IS3 family VFG1553 Protein 3e-23 54